KEGG   Rattus norvegicus (rat): 114244
Entry
114244            CDS       T01003                                 

Gene name
Hcn2
Definition
(RefSeq) potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
  KO
K04955  hyperpolarization activated cyclic nucleotide-gated potassium channel 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    114244 (Hcn2)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    114244 (Hcn2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    114244 (Hcn2)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (HCN)
   114244 (Hcn2)
SSDB
Motif
Pfam: Ion_trans Ion_trans_N cNMP_binding Ion_trans_2
Other DBs
NCBI-GeneID: 114244
NCBI-ProteinID: NP_446136
RGD: 620689
Ensembl: ENSRNOG00000008831
UniProt: Q9JKA9
Position
7
AA seq 863 aa
MDARGGGGRPGDSPGATPAPGPPPPPPPPAPPQPQPPPAPPPNPTTPSHPESADEPGPRS
RLCSRDSSCTPGAAKGGANGECGRGEPQCSPEGPARGPKVSFSCRGAASGPAAAEEAGSE
EAGPAGEPRGSQASFLQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPY
SDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGI
VIEDNTEIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGIDSEVYKTARALRIVR
FTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFL
VPMLQDFPSDCWVSINNMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLS
MIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHR
YQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQP
GDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTY
CRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLHKVQHDLSSGVFNNQE
NAIIQEIVKYDREMVQQAELGQRVGLFPPPPPPQVTSAIATLQQAVAMSFCPQVARPLVG
PLALGSPRLVRRAPPGPLPPAASPGPPAASPPAAPSSPRAPRTSPYGVPGSPATRVGPAL
PARRLSRASRPLSASQPSLPHGAPAPSPAASARPASSSTPRLGPAPTTRTAAPSPDRRDS
ASPGAASGLDPLDSARSRLSSNL
NT seq 2592 nt   +upstreamnt  +downstreamnt
atggatgcgcgcgggggcggcgggcggccgggcgatagtccgggcgcgacccctgcgccg
gggccgccgccaccgccgccgccgcccgcgccccctcagcctcagccaccacccgcgcca
cccccgaaccccacgaccccctcgcacccggagtcggcggacgagcccggcccgcgctcc
cggctctgcagccgcgacagctcctgcactcctggcgcggccaagggcggcgcgaatggc
gagtgcgggcgcggggagccgcagtgcagccccgagggccccgcgcgcggccccaaggtt
tcgttctcatgtcgcggggcggcctcggggcccgcggcggccgaggaggcgggcagcgag
gaggcgggcccggcgggtgagccgcgcggcagccaggccagcttcctgcagcgccaattc
ggggcgctcctgcagccgggcgtcaacaagttctccctgcggatgtttggcagccagaag
gccgtggagcgcgagcaggaacgcgtgaagtcggcgggggcctggatcatccacccctac
agcgacttcaggttctactgggacttcaccatgctgttgttcatggtgggaaatctcatc
atcatccctgtgggcatcactttcttcaaggacgagaccacggcgccctggatcgtcttc
aacgtggtctcggacactttcttcctcatggacttggtgctgaactttcgcaccggcatt
gttattgaggacaacacggagatcatcctggaccccgaaaagataaagaaaaagtacctg
cgtacgtggttcgtggtagacttcgtgtcatccatcccggtggactacatcttcctcatc
gtggagaagggaatcgactccgaggtctacaagacggcccgtgcactacgcatcgtgcgt
ttcaccaagatcctcagtctgctgcggttgctgcggctatcccggctcatccgatatatc
caccaatgggaggagattttccacatgacctacgacctggcaagcgcggtgatgcgcatc
tgtaacctgatcagcatgatgctgctgctctgccactgggacggctgcctgcagttcctg
gtgcccatgctgcaagacttccccagcgactgctgggtgtccatcaacaacatggtgaac
cactcgtggagcgaactctattcgttcgcgctcttcaaggccatgagccacatgctctgt
attggctacgggcggcaggctcccgagagcatgacggacatctggctcaccatgctcagc
atgatcgtgggcgccacctgctacgctatgttcattgggcacgccacggcgcttatccag
tccctggactcgtcacggcgccagtaccaggagaagtacaagcaagtggagcagtacatg
tccttccacaaactgccggctgacttccgccagaagatccacgattactatgaacaccgg
taccaggggaagatgtttgacgaggacagcatcctgggggaactcaacggcccactgcgt
gaggagattgtgaacttcaactgccggaagctggtggcttccatgccgttgtttgccaac
gcagaccccaacttcgtcaccgccatgctgacaaagctcaaatttgaggtcttccagcct
ggagactacatcatccgagaggggaccatcgggaagaagatgtacttcatccagcacggg
gtggtgagcgtgctcaccaagggcaacaaggagatgaagctgtcagatggctcctatttt
ggggagatctgcctgctcacgaggggccggcgcacagccagtgtgcgggctgacacctac
tgtcgcctctactcactgagcgtggacaacttcaacgaggtgctggaggagtaccccatg
atgcggcgtgcctttgagaccgtggccattgaccgcctggaccgcataggcaagaagaac
tccatcttgctacacaaggttcagcatgatctcagctcgggtgtgttcaacaaccaggag
aacgccatcatccaggagattgtcaaatatgaccgtgagatggtgcagcaggcagagctg
ggccagcgtgtggggctcttcccaccaccgccaccaccgcaggtcacgtcggccatcgcc
acactgcagcaggccgtggccatgagcttctgcccgcaggtggcccgcccgctcgtgggg
cccctggcgctagggtccccacgcctcgtgcgccgcgcgcccccagggcctctgcctcct
gcagcctcaccagggccacccgcagcgagccccccggctgcaccctcgagccctcgggca
ccgcggacctcaccctacggtgtgcctggctctccggcaacgcgtgtggggcccgcattg
cccgcacgccgcctgagccgcgcctcgcgcccactgtccgcctcgcagccctcgctgccc
cacggcgcgcccgcacccagccccgcggcctctgcgcgcccggccagcagctccaccccg
cgtctgggacccgcacccaccacccggaccgcggcacccagtccggaccgcagggactca
gcctcgccgggcgctgccagtggcctcgacccactggactctgcgcgctcgcgcctctct
tccaacttgtga

KEGG   Rattus norvegicus (rat): 114245
Entry
114245            CDS       T01003                                 

Gene name
Hcn3
Definition
(RefSeq) potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3
  KO
K04956  hyperpolarization activated cyclic nucleotide-gated potassium channel 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    114245 (Hcn3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    114245 (Hcn3)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (HCN)
   114245 (Hcn3)
SSDB
Motif
Pfam: Ion_trans Ion_trans_N cNMP_binding Ion_trans_2
Other DBs
NCBI-GeneID: 114245
NCBI-ProteinID: NP_446137
RGD: 620691
Ensembl: ENSRNOG00000020444
UniProt: Q9JKA8
Position
2
AA seq 780 aa
MEEEARPAVGDGEAATPARETPPAAPAQARAASGGVPESAPEPKRRQLGTLLQPTVNKFS
LRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFKEE
NSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGAEILLAPRAIRTRYLRTWFLVDLISSI
PVDYIFLVVELEPRLDAEVYKTARALRIVRFTKILSLLRLLRLSRLIRYMHQWEEIFHMT
YDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSMNRMVNHSWGRQYSHA
LFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQ
EKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFDEESILGELSEPLREEIINFTCRG
LVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLARGAR
DTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETVAM
DRLRRIGKKNSILQRKRSEPSPGSSSGGVMEQHLVQHDRDMARGIRGLAPGTGARLSGKP
VLWEPLVHAPLQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSARRSAGSPASPLVPV
RAGPLLARGPWASTSRLPAPPARTLHASLSRTGRSQVSLLGPPPGGGGRRLGPRGRPLSA
SQPSLPQRATGDGSPRRKGSGSERLPPSGLLAKPPGTVQPSRSSVPEPVTPRGPQISANM
NT seq 2343 nt   +upstreamnt  +downstreamnt
atggaggaggaggcgcggccggcggtgggggacggggaagcggcgactcctgcacgcgag
acgcctcctgcggctcccgcccaggcccgcgcggcctcaggtggggtgccagagtctgcg
cccgagccgaagaggcggcagctcgggacgctgctgcagccgaccgtcaacaagttctct
ctccgggtcttcggcagccacaaagcggtggaaatcgagcaggagagggtgaagtccgcc
ggggcctggatcatccacccctacagcgacttccggttttactgggacctgatcatgctg
ctgctgatggtggggaacctcatagtactgcccgtgggcatcactttcttcaaggaggag
aactccccaccctggatcgtcttcaatgtcctctcggacactttcttcctgctggatctg
gtgctcaacttccgaactggcatcgtggtggaggaaggtgcggagatcctgttggcgccc
agggctatccgcacgcgttacctgcgcacctggttcctggtggacctgatttcctccatc
cctgtggattacatcttcctagtggtagagctggagccacgactagacgctgaggtctac
aaaacggcacgggccctgcgcatcgttagattcaccaagatccttagcctgctgcggctg
ctccgcctctcccgcctcatccgatacatgcaccagtgggaggagatctttcacatgacc
tacgacctggccagtgcagtggttcgcatcttcaacctcattggaatgatgttgctgctg
tgtcactgggatggctgtctgcagttcctggtccctatgctgcaggacttcccttccgac
tgctgggtctccatgaaccgcatggtgaaccactcgtggggccgccagtactcccacgcc
ctgttcaaggccatgagtcacatgctgtgcattggctacgggcagcaggcaccagtaggc
atgcctgacgtctggctcaccatgctcagcatgattgtgggcgccacctgctatgccatg
ttcatcggccacgccaccgccctcatccagtccctggactcgtcccggcgccagtaccag
gagaagtacaagcaggtggagcagtacatgtccttccacaagctgccagccgacacacgg
cagcgcatccacgagtactacgagcatcggtaccagggcaagatgttcgatgaagagagc
atcctgggggagctgagcgagccgcttcgggaggagattattaacttcacctgccggggc
ctggtggcccacatgccgctgtttgctcatgctgaccccagtttcgtcaccgcagtactc
accaagctccgttttgaggtcttccaacctggggatctggtggtgcgtgagggctccgtg
ggcaggaagatgtacttcatccagcatgggctgctcagtgtgttggcacggggcgcccgg
gacactcgcctcactgacggatcctactttggggagatctgcctgctgactcgaggtcgg
agaacagccagtgtaagggctgacacctactgtcgcctctactcactcagcgtggaccac
ttcaatgcagtgcttgaggagttcccgatgatgcgcagggcttttgagactgtggccatg
gaccggcttcggcgcatcggcaaaaagaattcgatattgcagcggaaacgctctgagccg
agtccaggcagcagcagtggtggcgtcatggagcagcatttggtacaacacgacagagac
atggctcgtggtattcggggtctggctccgggcacaggagctcgcctcagtggaaagcca
gtgctgtgggaaccactggtacacgcacctctgcaggcagctgctgtgacctccaacgtg
gccatagccttgactcatcagcgaggccctctgcccctctcccctgattctccagccacc
ctcctggctcgatctgctagacgctcagcaggctccccagcctccccactggtgcctgtc
cgagcaggtcctctgctggcccggggaccctgggcgtccacttctcgcctgcctgctcca
cctgcccgaaccctccatgccagcctatcccggacagggcgttcccaggtgtctctgttg
ggccctcccccaggaggaggtggtcggaggctaggacctcggggccgcccactctctgcc
tctcaaccctctctgcctcagcgagccacgggggatggctctcctaggcgcaaaggctct
ggaagtgagcgtctgcccccctcggggctcctggccaagcctccagggactgtccagcca
tccaggtcatcagtgcctgagccagttacccccagaggtccccaaatttctgccaacatg
tga

KEGG   Rattus norvegicus (rat): 84390
Entry
84390             CDS       T01003                                 

Gene name
Hcn1
Definition
(RefSeq) potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1
  KO
K04954  hyperpolarization activated cyclic nucleotide-gated potassium channel 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    84390 (Hcn1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    84390 (Hcn1)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (HCN)
   84390 (Hcn1)
SSDB
Motif
Pfam: Ion_trans_N Ion_trans cNMP_binding TFIIA Ion_trans_2 DUF1759 Peptidase_S49_N
Other DBs
NCBI-GeneID: 84390
NCBI-ProteinID: NP_445827
RGD: 620688
Ensembl: ENSRNOG00000055382
UniProt: Q9JKB0
Position
2
AA seq 910 aa
MEGGGKPNSASNSRDDGNSVYPSKAPATGPAAADKRLGTPPGGGAAGKEHGNSVCFKVDG
GGGEEPAGSFEDAEGPRRQYGFMQRQFTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAG
FWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNVASDTVFLLDLI
MNFRTGTVNEDSSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIVEKGMDSEVYKTA
RALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHW
DGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIGYGAQAPVSMSD
LWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKI
HDYYEHRYQGKIFDEENILSELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKL
RFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEMKLTDGSYFGEICLLTKGRRTA
SVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLQKFQKDLNT
GVFNNQENEILKQIVKHDREMVQAIPPINYPQMTALNCTSSTTTPTSRMRTQSPPVYTAT
SLSHSNLHSPSPSTQTPQPSAILSPCSYTTAVCSPPIQSPLATRTFHYASPTASQLSLMQ
QPQPQLQQSQVQQTQTQTQQQQQQQQPQPQPQQPQQQQQQQQQQQQQQQQQQQQQPQTPG
SSTPKNEVHKSTQALHNTHLTREVRPLSASQPSLPHEVSTMISRPHPTVGESLASIPQPV
ATVHSTGLQAGSRSTVPQRVTLFRQMSSGAIPPNRGVPPAPPPPAAVQRESPSVLNKDPD
AEKPRFASNL
NT seq 2733 nt   +upstreamnt  +downstreamnt
atggaaggcggcggcaagcccaactccgcttccaacagccgcgacgatggcaacagcgtc
tacccctccaaggcgcccgcgacggggccggcggcggccgacaagcgcctggggaccccg
ccggggggcggcgcggccgggaaggaacacggcaactccgtgtgcttcaaggtggacggc
ggcggaggagaggagccggcgggcagcttcgaggatgccgaggggccccggcgacagtac
ggtttcatgcagaggcagttcacctccatgctgcagcctggggtcaacaaattctccctc
cgcatgttcgggagccagaaggcggtggagaaggagcaggaaagggttaaaactgcaggc
ttctggattatccatccgtacagtgacttcaggttttattgggatttaataatgcttata
atgatggttggaaatttggtcatcataccagttggaatcacattcttcacagagcaaaca
acaacaccgtggattattttcaatgtggcatcagatacagttttcctgttggacctaatc
atgaattttaggactgggactgtcaacgaagacagctctgaaatcatcctggaccctaaa
gtaatcaagatgaattatttaaaaagctggttcgtggtggacttcatctcctcgatcccg
gtggattatatctttcttattgtagagaaaggaatggattcggaagtttacaagaccgcc
agagcacttcggatcgtgaggtttacaaaaattctcagtctcttgcgtttattacgcctt
tcaaggttaattagatacatacaccagtgggaagagatattccacatgacatatgatctc
gccagtgcagtggtgagaatcttcaacctcattggcatgatgctgctcctgtgtcactgg
gatggctgtcttcagtttctggtccccctgctgcaggacttcccaccggattgctgggtt
tctctaaatgaaatggttaatgattcatgggggaaacagtattcctacgcactcttcaaa
gctatgagtcacatgctgtgcattggttatggcgcccaggcccccgtcagcatgtctgac
ctctggattaccatgctgagcatgattgttggggccacctgctatgccatgtttgtcggc
catgccacagctttgatccagtctctggattcttcaaggaggcagtatcaagagaagtac
aagcaagtagagcaatacatgtcattccacaagttaccagctgacatgcgccagaagata
catgattactatgagcaccgataccaaggcaagatcttcgatgaggaaaatattctcagt
gaacttaatgatcctctgagagaggaaatagtcaacttcaactgccggaaactggtggcc
accatgcctctctttgctaacgcggatcccaatttcgtgacggccatgctgagcaagctg
agatttgaggtgttccagcccggagactatatcattcgagaaggagctgtggggaagaaa
atgtatttcatccagcatggtgtggctggtgtcatcaccaagtccagtaaagaaatgaag
ttgacagacggctcttactttggagaaatatgcctgctgaccaagggccggcgcactgcc
agtgttcgagctgatacatactgtcgcctttactccctttcggtggacaatttcaacgag
gtcttggaggaatatccaatgatgagaagagcctttgagacagttgctattgaccgacta
gatcggataggcaagaaaaactctattctcctgcagaagttccagaaggatctgaacact
ggtgttttcaacaaccaggagaatgagatcctgaagcagattgtgaagcatgacagagag
atggtacaagcgatccctccaatcaactatcctcaaatgacagccctgaattgcacatct
tcaaccaccaccccaacgtcgcgcatgaggacccaatctccaccagtctacacagcgacc
agcctctctcacagcaacctgcactcacccagccccagcacacagacgcctcaaccctca
gccatcctttcaccctgctcctacaccacagcagtctgcagtcctcctatacagagcccc
ctggccacgcgaactttccattatgcctctcccactgcatcccaattgtcactcatgcag
cagcctcagccgcagctacagcaatcccaggtacagcagactcagactcagactcagcag
cagcagcagcaacagcagccgcagccgcagccgcagcagccgcaacagcaacaacagcag
caacagcagcagcagcagcagcagcaacaacagcagcagcaacagccacagacacctggt
agttccacaccgaaaaatgaagtgcacaagagcactcaagctcttcataacacccacctg
accagagaagtcaggcccctctctgcctcgcagccttcgctgccccatgaggtctccact
atgatctccagaccgcatcccactgtgggcgagtccctggcttccatccctcaacccgtg
gcaacagtccacagcactggccttcaggcagggagcaggagcaccgtgccacagcgtgtc
accttgttcagacagatgtcctcgggagccattccccccaaccgaggagtgcctccagca
cccccgccaccagcagctgtgcagagagagtctccctcagtcttaaataaagacccagat
gcagaaaaaccccgttttgcttcgaatttatga

DBGET integrated database retrieval system