KEGG   Rattus norvegicus (rat): 114483Help
Entry
114483            CDS       T01003                                 

Gene name
Cdk6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04115  p53 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04218  Cellular senescence
rno04934  Cushing syndrome
rno05160  Hepatitis C
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05206  MicroRNAs in cancer
rno05212  Pancreatic cancer
rno05214  Glioma
rno05218  Melanoma
rno05220  Chronic myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    114483 (Cdk6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114483 (Cdk6)
   04115 p53 signaling pathway
    114483 (Cdk6)
   04218 Cellular senescence
    114483 (Cdk6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114483 (Cdk6)
   05206 MicroRNAs in cancer
    114483 (Cdk6)
   05203 Viral carcinogenesis
    114483 (Cdk6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    114483 (Cdk6)
   05225 Hepatocellular carcinoma
    114483 (Cdk6)
   05214 Glioma
    114483 (Cdk6)
   05220 Chronic myeloid leukemia
    114483 (Cdk6)
   05218 Melanoma
    114483 (Cdk6)
   05224 Breast cancer
    114483 (Cdk6)
   05222 Small cell lung cancer
    114483 (Cdk6)
   05223 Non-small cell lung cancer
    114483 (Cdk6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    114483 (Cdk6)
  09172 Infectious disease: viral
   05162 Measles
    114483 (Cdk6)
   05164 Influenza A
    114483 (Cdk6)
   05160 Hepatitis C
    114483 (Cdk6)
   05163 Human cytomegalovirus infection
    114483 (Cdk6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    114483 (Cdk6)
   05169 Epstein-Barr virus infection
    114483 (Cdk6)
   05165 Human papillomavirus infection
    114483 (Cdk6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    114483 (Cdk6)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     114483 (Cdk6)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  CDK family
   114483 (Cdk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase Kdo Kinase-like RIO1 FTA2
Motif
Other DBs
NCBI-GeneID: 114483
NCBI-ProteinID: NP_001178790
RGD: 621121
Ensembl: ENSRNOG00000009258
UniProt: F1MA87
Position
4q13
AA seq 326 aa AA seqDB search
MEKDSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAELFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYGALNHPYF
QDLERYKDNLHSHLSSSQSTSELNTA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggacagcctgagtcgcgccgaccagcagtatgagtgcgtggcggagatcggg
gaaggcgcctacgggaaggtgttcaaggcccgcgacctgaagaacggcggccgcttcgtg
gctctgaagcgcgtgcgagtgcagaccggagaggagggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagacctttgagcaccccaacgtggtcaggttgttt
gacgtgtgcacagtgtcacggacagacagagaaactaaacttacgctagtgtttgagcat
gttgatcaagacttgaccacttacttggataaagttccagaacccggtgtgcccacagag
accataaaggatatgatgtttcagcttctccgaggtctggacttcctccattctcacaga
gtagtgcatcgtgacctgaagccacagaacattctggtgaccagcagtggacaaataaaa
ctggctgacttcggccttgcccgcatctacagttttcagatggcccttacctcggtggtc
gtcacgctgtggtaccgagccccggaagtcctgctccagtccagctacgccacccccgtg
gacctctggagtgttggctgcatctttgcagaactgtttcgcagaaagcctctttttcgt
ggaagttcagacgtggatcaactagggaaaatcttggacgtcatcggactcccaggagaa
gaagactggcctagggatgttgctcttcccagacaggcttttcactccaaatctgcccaa
cccatcgagaagtttgtgacagacatcgacgagctaggcaaagacctccttctgaaatgc
ttgacgtttaatccagctaaaagaatatccgcttatggcgccctgaatcacccgtacttc
caagacctggagagatacaaggacaacctgcattctcacctgtcgtccagccagagcacc
tcggagctgaacacagcctga

DBGET integrated database retrieval system