KEGG   Rattus norvegicus (rat): 114483
Entry
114483            CDS       T01003                                 

Gene name
Cdk6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04115  p53 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04218  Cellular senescence
rno04934  Cushing syndrome
rno05160  Hepatitis C
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05206  MicroRNAs in cancer
rno05212  Pancreatic cancer
rno05214  Glioma
rno05218  Melanoma
rno05220  Chronic myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    114483 (Cdk6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114483 (Cdk6)
   04115 p53 signaling pathway
    114483 (Cdk6)
   04218 Cellular senescence
    114483 (Cdk6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114483 (Cdk6)
   05206 MicroRNAs in cancer
    114483 (Cdk6)
   05203 Viral carcinogenesis
    114483 (Cdk6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    114483 (Cdk6)
   05225 Hepatocellular carcinoma
    114483 (Cdk6)
   05214 Glioma
    114483 (Cdk6)
   05220 Chronic myeloid leukemia
    114483 (Cdk6)
   05218 Melanoma
    114483 (Cdk6)
   05224 Breast cancer
    114483 (Cdk6)
   05222 Small cell lung cancer
    114483 (Cdk6)
   05223 Non-small cell lung cancer
    114483 (Cdk6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    114483 (Cdk6)
   05164 Influenza A
    114483 (Cdk6)
   05162 Measles
    114483 (Cdk6)
   05163 Human cytomegalovirus infection
    114483 (Cdk6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    114483 (Cdk6)
   05169 Epstein-Barr virus infection
    114483 (Cdk6)
   05165 Human papillomavirus infection
    114483 (Cdk6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    114483 (Cdk6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    114483 (Cdk6)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     114483 (Cdk6)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  CDK family
   114483 (Cdk6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH ABC1 Kdo Haspin_kinase Kinase-like RIO1 FTA2 TCAD9
Other DBs
NCBI-GeneID: 114483
NCBI-ProteinID: NP_001178790
RGD: 621121
Ensembl: ENSRNOG00000009258
UniProt: F1MA87
Position
4
AA seq 326 aa
MEKDSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAELFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYGALNHPYF
QDLERYKDNLHSHLSSSQSTSELNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacagcctgagtcgcgccgaccagcagtatgagtgcgtggcggagatcggg
gaaggcgcctacgggaaggtgttcaaggcccgcgacctgaagaacggcggccgcttcgtg
gctctgaagcgcgtgcgagtgcagaccggagaggagggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagacctttgagcaccccaacgtggtcaggttgttt
gacgtgtgcacagtgtcacggacagacagagaaactaaacttacgctagtgtttgagcat
gttgatcaagacttgaccacttacttggataaagttccagaacccggtgtgcccacagag
accataaaggatatgatgtttcagcttctccgaggtctggacttcctccattctcacaga
gtagtgcatcgtgacctgaagccacagaacattctggtgaccagcagtggacaaataaaa
ctggctgacttcggccttgcccgcatctacagttttcagatggcccttacctcggtggtc
gtcacgctgtggtaccgagccccggaagtcctgctccagtccagctacgccacccccgtg
gacctctggagtgttggctgcatctttgcagaactgtttcgcagaaagcctctttttcgt
ggaagttcagacgtggatcaactagggaaaatcttggacgtcatcggactcccaggagaa
gaagactggcctagggatgttgctcttcccagacaggcttttcactccaaatctgcccaa
cccatcgagaagtttgtgacagacatcgacgagctaggcaaagacctccttctgaaatgc
ttgacgtttaatccagctaaaagaatatccgcttatggcgccctgaatcacccgtacttc
caagacctggagagatacaaggacaacctgcattctcacctgtcgtccagccagagcacc
tcggagctgaacacagcctga

KEGG   Rattus norvegicus (rat): 94201
Entry
94201             CDS       T01003                                 

Gene name
Cdk4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04110  Cell cycle
rno04115  p53 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04218  Cellular senescence
rno04530  Tight junction
rno04660  T cell receptor signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04934  Cushing syndrome
rno05160  Hepatitis C
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05212  Pancreatic cancer
rno05214  Glioma
rno05218  Melanoma
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    94201 (Cdk4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    94201 (Cdk4)
   04115 p53 signaling pathway
    94201 (Cdk4)
   04218 Cellular senescence
    94201 (Cdk4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    94201 (Cdk4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    94201 (Cdk4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    94201 (Cdk4)
   05203 Viral carcinogenesis
    94201 (Cdk4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    94201 (Cdk4)
   05225 Hepatocellular carcinoma
    94201 (Cdk4)
   05214 Glioma
    94201 (Cdk4)
   05220 Chronic myeloid leukemia
    94201 (Cdk4)
   05218 Melanoma
    94201 (Cdk4)
   05219 Bladder cancer
    94201 (Cdk4)
   05224 Breast cancer
    94201 (Cdk4)
   05222 Small cell lung cancer
    94201 (Cdk4)
   05223 Non-small cell lung cancer
    94201 (Cdk4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    94201 (Cdk4)
   05160 Hepatitis C
    94201 (Cdk4)
   05164 Influenza A
    94201 (Cdk4)
   05162 Measles
    94201 (Cdk4)
   05163 Human cytomegalovirus infection
    94201 (Cdk4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    94201 (Cdk4)
   05169 Epstein-Barr virus infection
    94201 (Cdk4)
   05165 Human papillomavirus infection
    94201 (Cdk4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    94201 (Cdk4)
   04934 Cushing syndrome
    94201 (Cdk4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    94201 (Cdk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    94201 (Cdk4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     94201 (Cdk4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  CDK family
   94201 (Cdk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase ABC1 Kdo TCAD9 Kinase-like
Other DBs
NCBI-GeneID: 94201
NCBI-ProteinID: NP_446045
RGD: 621120
Ensembl: ENSRNOG00000025602
UniProt: P35426
Position
7
AA seq 303 aa
MATTRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDL
MRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
EVSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLEMLTFNPLKRISAFRALQHSYLHKEES
DPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctaccactcgatatgaacccgtggctgaaattggtgtcggtgcctatgggacggtg
tacaaagcccgagatccccacagtggccactttgtggctctcaagagtgtgagagttcct
aatggaggagcagctggagggggccttcccgtcagcacagttcgtgaggtggccttgtta
agaaggctggaggcctttgaacatcccaatgttgtacggctgatggatgtctgtgctact
tcccgaactgatcgggacatcaaggtcaccttagtgtttgagcatatagaccaggaccta
cggacatacctggacaaagcacctccgccgggcttgcctgttgagaccattaaggatctg
atgcgccagtttctaagcggcctagatttccttcatgcaaactgcattgttcaccgggac
ctgaagccagagaacattctagtgacaagtaatgggacagttaagctggccgactttggc
ctagccagaatctacagctaccagatggccctcacgcctgtggttgttacgctctggtac
cgggctcctgaagttcttctgcagtctacatatgcaacgcctgtggatatgtggagtgtt
ggctgtatcttcgcagagatgtttcgccggaagcctctcttctgtgggaactctgaggct
gaccagctgggcaaaatctttgatctcattggattgcctccagaagacgactggcctcga
gaggtctctcttcctcgaggagccttttcccccagaggacctcggccagtgcagtcagtg
gtgccggagatggaggaatctggagcgcagttgctgctggaaatgctgacctttaatcca
cttaagcgaatctctgccttccgagccctgcagcactcttacctgcacaaggaggaaagt
gacccggagtga

DBGET integrated database retrieval system