KEGG   Rattus norvegicus (rat): 114485Help
Entry
114485            CDS       T01003                                 

Gene name
Dmtf1
Definition
(RefSeq) cyclin D binding myb-like transcription factor 1
  KO
K21625  cyclin-D-binding Myb-like transcription factor 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    114485 (Dmtf1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-like factors
    114485 (Dmtf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_6 Myb_DNA-bind_4 DUF3818
Motif
Other DBs
NCBI-GeneID: 114485
NCBI-ProteinID: NP_446145
RGD: 70966
Ensembl: ENSRNOG00000005908
UniProt: Q66HG1
Position
4q12
AA seq 690 aa AA seqDB search
MSTVEEDSDTVTVETVNSVTFTQDTDGNLILHCPQNDPDEIDSEDSTEPPHKRLCLSSED
DQSIDDSTPCISVVALPLSENDQSFEVTMTATTEVADDELSEGTVTQIQILQNDQLDEMS
PLGTEEVSAVSQAWFTTKEDKDSLTNKGHKWKQGMWSKEEIDILMNNIERYLKARGIKDA
TEIIFEMSKDERKDFYRTIAWGLNRPLFAVYRRVLRMYDDRNHVGKYTPEEIEKLKELRI
KHGNDWATIGAALGRSASSVKDRCRLMKDTCNTGKWTEEEEKRLAEVVHELTSTEPGDIV
TQGVSWAAVAERVGTRSEKQCRSKWLNYLNWKQSGGTEWTKEDEINLILRIAELDVADEN
DINWDLLAEGWSSVRSPQWLRSKWWTIKRQIANHKDVSFPASTDSPAASVDSETITLNSG
TLQTFEILPSFHLQPTGTPGTYLLQTSSSQGLPLTLTTSPTVTLAAAAPASPEQIIVHAL
SPEHLLNTSDNVTVQCHTPRVIIQTVATEDITSSISQAELTADSDLHSSDFPEPPDALEA
DTFPDEIPRPKMTIQPSFNNAHVSKYSDQNSTELMNSVMVRTEEEIADTDLKQEPPSDLA
SAYVTEDLESPTIVHQVHQTIDDETILIVPSPHGFIQASDGIDAESVLPLTTLTDPIFQH
HQEESNIIGSSLGSPVSEDSKDVEDLVNCH
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagttgaagaggattctgacacagtaacagtagaaactgtgaattctgtgacg
tttactcaggacacagacgggaacctcattcttcattgccctcagaatgaccctgatgaa
atagactcagaagacagtactgaacctccacataagaggctttgtttgtcctccgaggat
gatcagagcattgatgactctacaccgtgcatatcggttgtggcactcccactttcagaa
aatgatcagagctttgaggtgaccatgacggcaactacagaggtggcagatgatgaactt
tctgagggaactgtgacacaaattcagattttacagaatgatcaactagatgagatgtct
ccattgggtactgaggaagtttctgcagttagccaagcatggtttacaactaaagaagac
aaggattctctcactaacaaaggacataaatggaagcaagggatgtggtccaaggaagaa
attgatattttgatgaacaacattgagcgctatctgaaggctcgcggaataaaagatgct
acagaaatcatctttgagatgtcaaaagacgaaagaaaagatttctacaggactattgcg
tgggggctgaaccggcctttgtttgcagtttatagaagagtgctgcgcatgtatgatgac
aggaaccatgtgggaaaatacactcctgaagaaattgagaagctcaaggagctccggata
aagcatggcaatgactgggcaacaataggggcggccctgggaagaagcgcctcttctgtc
aaagaccgctgccggctgatgaaggacacctgcaacacagggaaatggacagaagaagaa
gaaaagagacttgcagaggtagttcatgaattaacaagcacggagccaggtgacatcgtc
acacagggtgtgtcttgggcagctgtagcggaaagagtgggtacccgctcagaaaagcaa
tgccgttctaaatggctcaactacctgaactggaaacagagtgggggaactgagtggacc
aaggaagatgaaatcaatctcatcctcaggatagctgagcttgatgtagctgatgaaaat
gacataaactgggatcttctagctgagggatggagcagtgttcgttcaccacagtggctt
cgaagtaaatggtggaccatcaaaaggcaaatcgcaaaccataaggatgtttcgtttcct
gcttcaacagactcccctgctgcttctgttgactcagaaacaataacactaaacagtgga
acactgcaaacatttgagattcttccatctttccatttacagcctactggtactccaggc
acctaccttcttcaaacaagctcaagtcaaggccttcccctaacactgaccacaagtccc
acagtaaccctggcagctgctgctcctgcttctcctgaacagatcattgttcatgcttta
tccccggaacatttgttgaacacaagtgacaatgtcacagtacagtgtcacacaccaaga
gtcatcattcaaactgttgctacagaggacatcacttcttcaatatcccaagcagaactg
acagctgatagtgatcttcattcatctgattttcctgagcctccagatgcactagaagca
gacactttcccagatgaaattcctcggcctaagatgactatacaaccatcatttaataat
gctcatgtgtctaaatacagtgaccaaaatagcacagaactgatgaatagtgtcatggtc
agaacagaggaagaaattgctgacactgaccttaagcaagaaccaccttccgacttagcc
agtgcttatgttactgaggatttagagtctcctaccatagtacaccaagttcatcagaca
attgatgatgagacaatacttatcgttccttcaccacatggctttatccaggcatctgat
ggtatcgacgctgagtctgtcttgcctttgacaacactaacagatcccatatttcaacat
catcaggaagaatcgaatataattggatcatctttgggcagtcctgtttctgaggactca
aaggatgttgaggacttggtaaactgtcactag

DBGET integrated database retrieval system