KEGG   Rattus norvegicus (rat): 114486
Entry
114486            CDS       T01003                                 

Gene name
Braf
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X6
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04068  FoxO signaling pathway
rno04150  mTOR signaling pathway
rno04270  Vascular smooth muscle contraction
rno04510  Focal adhesion
rno04650  Natural killer cell mediated cytotoxicity
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04726  Serotonergic synapse
rno04730  Long-term depression
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05034  Alcoholism
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05216  Thyroid cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114486 (Braf)
   04012 ErbB signaling pathway
    114486 (Braf)
   04015 Rap1 signaling pathway
    114486 (Braf)
   04068 FoxO signaling pathway
    114486 (Braf)
   04024 cAMP signaling pathway
    114486 (Braf)
   04150 mTOR signaling pathway
    114486 (Braf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114486 (Braf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114486 (Braf)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    114486 (Braf)
   04062 Chemokine signaling pathway
    114486 (Braf)
  09152 Endocrine system
   04910 Insulin signaling pathway
    114486 (Braf)
   04914 Progesterone-mediated oocyte maturation
    114486 (Braf)
   04928 Parathyroid hormone synthesis, secretion and action
    114486 (Braf)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    114486 (Braf)
  09156 Nervous system
   04726 Serotonergic synapse
    114486 (Braf)
   04720 Long-term potentiation
    114486 (Braf)
   04730 Long-term depression
    114486 (Braf)
   04722 Neurotrophin signaling pathway
    114486 (Braf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114486 (Braf)
   05205 Proteoglycans in cancer
    114486 (Braf)
  09162 Cancer: specific types
   05210 Colorectal cancer
    114486 (Braf)
   05212 Pancreatic cancer
    114486 (Braf)
   05225 Hepatocellular carcinoma
    114486 (Braf)
   05226 Gastric cancer
    114486 (Braf)
   05214 Glioma
    114486 (Braf)
   05216 Thyroid cancer
    114486 (Braf)
   05221 Acute myeloid leukemia
    114486 (Braf)
   05220 Chronic myeloid leukemia
    114486 (Braf)
   05218 Melanoma
    114486 (Braf)
   05211 Renal cell carcinoma
    114486 (Braf)
   05219 Bladder cancer
    114486 (Braf)
   05215 Prostate cancer
    114486 (Braf)
   05213 Endometrial cancer
    114486 (Braf)
   05224 Breast cancer
    114486 (Braf)
   05223 Non-small cell lung cancer
    114486 (Braf)
  09172 Infectious disease: viral
   05161 Hepatitis B
    114486 (Braf)
   05160 Hepatitis C
    114486 (Braf)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114486 (Braf)
   05022 Pathways of neurodegeneration - multiple diseases
    114486 (Braf)
  09165 Substance dependence
   05034 Alcoholism
    114486 (Braf)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    114486 (Braf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    114486 (Braf)
   01522 Endocrine resistance
    114486 (Braf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    114486 (Braf)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114486 (Braf)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   114486 (Braf)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like ABC1 C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 114486
NCBI-ProteinID: XP_006236419
RGD: 619908
Ensembl: ENSRNOG00000010957
Position
4
AA seq 825 aa
MAALSGGGGSSSGGGGGGGGGGGGGGGGGAEQGQALFNGDMEPEAGAGAAASSAADPAIP
EEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLG
NGADFSVSSSASMDTVTSSSSSSLSVLPSSLSVFQTPTDVSRNNPKSPQKPIVRVFLPNK
QRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHV
EVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYD
QLDLLFVSKFFEHHPVPQEEAFSAETTLPSGCSSAPPSDSIGPQILTSPSPSKSIPIPQP
FRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGAPLNQLMRCLRKY
QSRTPSPLLHSVPSEIVFDFEPGPVFRGSTTGLSATPPASLPGSLTNVKALQKSPGPQRE
RKSSSSSSSTEDRSRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAV
KMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLH
IIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKS
RWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNR
DQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
KIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2478 nt   +upstreamnt  +downstreamnt
atggcggcgctgagtggcggcggtggcagcagcagcggtggcggtggcggcggcggcggc
ggcggtggtggcggcggcggcggcggcgccgaacagggacaggctctgttcaatggcgac
atggagccggaggccggcgctggcgccgcggcctcttcggccgcggacccggccattcct
gaagaggtgtggaatatcaagcaaatgattaagttgacacaggaacatatagaggcccta
ttggacaagtttggtggggagcataacccaccgtcaatatacctggaggcctatgaagag
tacaccagcaagctagatgcccttcagcagagagagcagcagctgttggaatccctgggt
aatggagcagacttttctgtttctagctctgcatcaatggacaccgttacatcttcctcc
tcttctagcctttcagtgctaccgtcatctctttcagtttttcaaactcccacagatgta
tcacggaacaaccccaagtcaccacagaaacctatcgttcgtgtcttcctgcccaacaaa
cagaggacagtggtgcccgcaagatgtggtgtaacggtccgagacagtctaaagaaagca
ctaatgatgaggggtctcatcccagagtgctgtgctgtttacagaattcaggacggagag
aagaaaccaattggctgggacactgacatttcctggcttactggagaggagctacatgtt
gaagtactagagaatgttcctctgacaacccacaacttcgtacggaaaacttttttcacc
ttagcattttgtgacttttgccgaaagctgcttttccagggtttccgctgtcaaacatgt
ggttataagtttcaccagcgttgtagtacagaggttccactgatgtgtgttaattatgac
caacttgatttgctgtttgtctccaagttctttgagcatcacccagtaccacaggaggag
gccttctcagcagagactacccttccatctggatgctcttccgcacccccctcagactct
attgggccccaaatcctcaccagtccatctccttcaaaatccattccaattccacagccc
ttccggccagcagatgaagatcatcgcaatcagtttgggcaacgagaccgctcctcctcc
gctcccaatgttcatataaacacaatcgaacctgtcaatattgatgatttgattagagac
caggggtttcgtggggatggagcccctttgaaccagctgatgcgctgtcttcggaaatac
caatcccggactcccagccccctcctccattctgtccccagtgaaatagtgtttgatttt
gagcctggcccagtgttcagagggtcaaccacaggcttgtcggccaccccacctgcctca
ttacctggctcactcactaacgtgaaagccttacagaaatctccaggacctcagcgggaa
aggaagtcctcctcctcctcctcctccacggaagacagaagtcggatgaaaacacttggt
agaagagattcaagtgatgattgggagattcctgatggacagattacagtgggacagaga
attggatctgggtcctttggaactgtctacaagggaaagtggcatggcgacgtggcagtg
aaaatgctgaatgtgacagcacccacacctcagcagttacaggccttcaaaaacgaagtc
ggagtactcaggaaaactcgacatgtgaacatcctccttttcatgggctattctacaaag
ccacagctggctattgttacacagtggtgtgaaggctccagcttatatcaccatctccac
atcattgagaccaaatttgagatgatcaaacttatagatattgcacggcagactgcacag
ggcatggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatata
tttcttcatgaagacctcacggtaaaaataggtgactttggtttagccacagtgaagtcc
cgatggagtgggtcccatcagtttgaacagttgtctggatctattttgtggatggcaccc
gaagtaatcagaatgcaagataaaaacccatatagctttcagtcagacgtgtatgcattt
gggattgttctgtatgaactgatgactggtcagctaccttattcaaacatcaacaacagg
gatcagataatttttatggtgggacgaggatacctatctccagatctcagtaaggtacgg
agtaactgtccaaaagccatgaagagattaatggcagagtgcctcaaaaagaaaagagac
gagagaccactctttccccaaattctcgcctctattgagctgctggcccgctcattgcca
aaaattcaccgcagtgcatcagaaccctccttgaatcgggctggtttccaaacagaagat
tttagtctgtatgcttgtgcttctccaaaaacacccatccaagcagggggatatggagaa
tttgcagccttcaagtag

DBGET integrated database retrieval system