KEGG   Rattus norvegicus (rat): 114489Help
Entry
114489            CDS       T01003                                 

Gene name
Dag1
Definition
(RefSeq) dystroglycan 1
  KO
K06265  dystroglycan 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04512  ECM-receptor interaction
rno05410  Hypertrophic cardiomyopathy (HCM)
rno05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
rno05414  Dilated cardiomyopathy (DCM)
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    114489 (Dag1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    114489 (Dag1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    114489 (Dag1)
   05414 Dilated cardiomyopathy (DCM)
    114489 (Dag1)
   05416 Viral myocarditis
    114489 (Dag1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAG1 a_DG1_N2 TMEM154 ATP1G1_PLM_MAT8
Motif
Other DBs
NCBI-GeneID: 114489
NCBI-ProteinID: NP_446149
RGD: 621890
Ensembl: ENSRNOG00000019400
UniProt: F1M8K0
Position
8q32
AA seq 893 aa AA seqDB search
MSVDNWLLHPLWGQTFLLLLSVAVAQAHWPSEPSEAVRDWKNQLEASMHSVLSDFQEAVP
TVVGIPDGTAVVGRSFRVSIPTDLIASSGEIIKVSAAGKEALPSWLHWDPHSHILEGLPL
DTDKGVHYISVSAARLGANGSHVPQTASVFSIEVYPEDHSEPQSVRAASSDPGEVVSSAC
AADEPVTVLTVILDADLTKMTPKQRIDLLNRMQSFSEVELNNMKLVPVVNNRLFDMSAFM
AGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRGVETPAREGTMSAHLGYPVVGWHIANK
KPTLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPV
PGKPTVTIRTRGAIIQTPTLGPIPPTRVSEAGTTVPGQIRPTLTIPGYVEPTAVVTPPTT
TTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPVPRVTTKAPITRLETASPPTRIRT
TTSAVPRGGEANQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDNEDTTTDKLKLTLKLRE
QQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQGD
KAPARFKAKLAGDPAPVVNDIHKKIALVKKLAFAFGDRNCSSITLQNITRGSIVVEWTNN
TLPLEPCPKEQIVGLSRRIADENGKPRPAFSNALEPDFKALSVAVAGSGSCRHLQFIPVA
PPSPGTSAAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGK
LTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTPL
NQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtggacaactggctactgcaccccctctggggacagacctttctcctcctactg
tctgtggctgtggctcaagcccactggcccagtgaaccctcagaggctgtgagggactgg
aagaaccagcttgaggcgtccatgcactcagttctctcggacttccaggaggctgttccc
accgtggttggcatcccagatggcacggctgttgttgggcgctcattccgagtgagcatt
ccaacagatttaattgcctccagtggagaaattatcaaggtgtctgcagcagggaaggag
gccctgccgtcctggctacactgggatccacacagtcatattttggaaggccttcctctt
gacactgataaaggtgtccattacatctcagtgagtgctgcacgcctgggagcaaatgga
agccacgtgccgcagacggccagcgtgttctctattgaggtctaccctgaagaccacagt
gagccacagtctgtccgggcagcctcatcagaccctggtgaagtagtgtcatctgcttgt
gcagctgatgagccagtgactgtccttacagtgattctggatgctgacctcaccaagatg
accccaaagcaaaggattgatctactgaacagaatgcagagcttctcagaagtagaactt
aacaacatgaagttggtgcctgtagtcaataatagactatttgacatgtcagccttcatg
gctggcccaggaaatgcaaagaaagtggtagagaatggggctctgctgtcctggaaacta
gggtgctccttgaatcagaatagcgtccctgacatccgcggtgtagaaacccctgctagg
gagggtaccatgtctgcccaccttggttatcctgtggtgggttggcacattgccaataag
aagcccactctccccaaacgaatccggaggcagatccatgccactcctacacctgttact
gccattggacccccaactaccgccattcaggagccaccatctaggatagtgcctactccc
acatctccagccattgcacctccaacagagaccatggctcctcctgttagggatcctgtc
ccagggaagcccacggtcaccattcggactcgaggtgccattattcagaccccaactctg
ggccctatccctcctactcgggtgtcagaagctggtaccacagttcctggccagattcgc
ccaacactgacaattcctggttatgtagagcccacagcagttgttactcctccaacaact
accacaaagaagccacgagtatctacgccaaaaccagcaacgccttcaactgattcgtca
actaccacaactcgaaggccaaccaaaaaaccacggacaccccgaccagtgccccgggtc
accaccaaagcaccgatcaccagattggagaccgcttccccacccactcgaatccgcact
accaccagtgcagtgccccgtgggggagaagctaaccagcggccagagcttaagaaccac
atcgacagggttgatgcctgggtaggaacctactttgaggtaaagattccatcagacacc
ttctatgacaatgaggacaccactacggacaagctcaagctgaccctgaagctgcgagag
cagcagttggtaggtgagaaatcttgggttcagtttaacagcaacagccagctcatgtat
ggtctgcctgacagcagccatgtcggaaaacatgagtatttcatgcacgccacggacaaa
gggggcctttctgctgtggatgccttcgagatccatgttcacaagcgcccacaaggggac
aaagctcccgcgcgattcaaggccaaacttgcaggggatcccgcacctgtggtgaacgat
atccacaagaagatcgctttggtaaagaagctggcttttgcctttggggataggaactgc
agctccatcacccttcagaacatcacccggggctctattgtggtcgagtggaccaacaac
actctgcccctggagccctgccccaaggagcagatcgtagggctgagccgcaggattgct
gatgaaaacgggaagcctcgtcctgccttctccaatgctctggagcctgacttcaaggct
ctgagtgttgctgtggcgggctctggcagttgtcggcacctccaatttatccccgtggca
ccaccctctcctggaacctcagcagcaccggccacagaggttccagacagggaccctgag
aagagcagtgaggatgacgtttacttgcacacagtcatcccagctgttgtggttgcagcc
atcctgctcattgctggaatcattgctatgatctgctatcgcaagaagaggaagggcaaa
ctgaccctggaggaccaggccacctttatcaagaagggggtgcctattatctttgcagat
gagctggatgactctaagcccccgccctcttccagcatgccgctcatcctgcaggaagag
aaggctcccctccctcctcctgagtaccctaaccagagtgtgcccgagaccactcctctg
aaccaggacactgtgggagagtacacacccctgcgggatgaggatcctaatgcacctccc
taccagccacccccacccttcacagctcccatggagggcaagggctcccgtcccaagaac
atgaccccataccgatcaccccctccatatgtacccccttaa

DBGET integrated database retrieval system