KEGG   Rattus norvegicus (rat): 114493
Entry
114493            CDS       T01003                                 

Gene name
Cacna1f
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1F
  KO
K04853  voltage-dependent calcium channel L type alpha-1F
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04723  Retrograde endocannabinoid signaling
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04921  Oxytocin signaling pathway
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04929  GnRH secretion
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno05010  Alzheimer disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114493 (Cacna1f)
   04020 Calcium signaling pathway
    114493 (Cacna1f)
   04024 cAMP signaling pathway
    114493 (Cacna1f)
   04022 cGMP-PKG signaling pathway
    114493 (Cacna1f)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    114493 (Cacna1f)
   04929 GnRH secretion
    114493 (Cacna1f)
   04912 GnRH signaling pathway
    114493 (Cacna1f)
   04921 Oxytocin signaling pathway
    114493 (Cacna1f)
   04935 Growth hormone synthesis, secretion and action
    114493 (Cacna1f)
   04924 Renin secretion
    114493 (Cacna1f)
   04925 Aldosterone synthesis and secretion
    114493 (Cacna1f)
   04927 Cortisol synthesis and secretion
    114493 (Cacna1f)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    114493 (Cacna1f)
   04261 Adrenergic signaling in cardiomyocytes
    114493 (Cacna1f)
   04270 Vascular smooth muscle contraction
    114493 (Cacna1f)
  09156 Nervous system
   04727 GABAergic synapse
    114493 (Cacna1f)
   04725 Cholinergic synapse
    114493 (Cacna1f)
   04726 Serotonergic synapse
    114493 (Cacna1f)
   04723 Retrograde endocannabinoid signaling
    114493 (Cacna1f)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114493 (Cacna1f)
   05020 Prion disease
    114493 (Cacna1f)
   05022 Pathways of neurodegeneration - multiple diseases
    114493 (Cacna1f)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    114493 (Cacna1f)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    114493 (Cacna1f)
   05414 Dilated cardiomyopathy
    114493 (Cacna1f)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    114493 (Cacna1f)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    114493 (Cacna1f)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   114493 (Cacna1f)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 114493
NCBI-ProteinID: NP_446153
RGD: 621535
Ensembl: ENSRNOG00000010348
UniProt: Q923Z7
Position
X
AA seq 1980 aa
MSESEVGKDTTPEPSPANGTGPGPEWGLCPGPPTVGTDTSGASGLGTPRRRTQHNKHKTV
VVASAQRSPRALFCLTLTNPIRRSCISIVEWKPFDILILLTIFANCVALGVYIPFPEDDS
NTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVLL
EQGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHI
ALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDMEAEEDPSPCASSGSGRSCTLNQTECR
GRWPGPNGGITNFDNFFFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGS
FFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQMEEDLRGYLDWITQAEELDLHDPS
VDGNLASLAEEGRAGHRPQLSELTNRRRGRLRWFSHSTRSTHSTSSHASLPASDTGSITD
TPGDEDEEEGTMASCTLCLNKIMKTKVCRHFRRANRGLRARCRRAVKSNACYWAVLLLVF
LNTLTIASEHHGQPVWLTQTQEYANKVLLCLFTVEMLLKLYGLGPSVYVASFFNRFDCFV
VCGGILETTLVEVGAMQPLGISVLRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLL
LLLFLFIIIFSLLGMQLFGGKFNFDQTHTKRSTFDTFPQALLTVFQILTGEDWNVVMYDG
IMAYGGPFFPGMLVCVYFIILFICGNYILLNVFLAIAVDNLASGDAGAAKDKGREKSSEG
NPPQENKVLVPGGENEDTEGTKSEGAAPGMEEEEEEEEEEEEENGAGHVELLQEVVPKEK
VVPIPEGSAFFCLSQTNPLRKACHTLIHHHVFTSLILVFIILSSVSLAAEDPIRAHSFRN
HILGYFDYAFTSIFTVEILLKMTVFGAFLHQGSFCRSWFNLLDLLVVSVSLISFGIHSSA
ISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQL
FKGKFYSCTDEAKHTLKECKGSFLIYPDGDVSRPLVRERLWVNSDFNFDNVLSAMMALFT
VSTFEGWPALLYKAIDAHAEDEGPIYNYHVEISVFFIVYIIIIAFFMMNIFVGFVIITFR
AQGEQEYQNCELDKNQRQCVEYALKAQPLRRYIPKNPHQYRVWATVNSAAFEYLMFLLIL
LNTVALAMQHYEQTAPFNYAMDILNMVFTGLFTVEMVLKIIAFKPKHYFADAWNTFDALI
VVGSVVDIAVTEVNNGGHLGESSEDSSRISITFFRLFRVMRLVKLLSKGEGIRTLLWTFI
KSFQALPYVALLIAMIFFIYAVIGMQMFGKVALQDGTQINRNNNFQTFPQAVLLLFRCAT
GEAWQEIMLASLPGNRCDPESDFGPGEEFTCGSNFAIVYFISFFMLCAFLIINLFVAVIM
DNFDYLTRDWSILGPHHLDEFKRIWSEYDPGAKGRIKHLDVVALLRRIQPPLGFGKLCPH
RVACKRLVAMNVPLNSDGTVTFNATLFALVRTSLRIKTEGNLDQANQELRMVIKKIWKRI
KQKLLDEVIPPPDEEEVTVGKFYATFLIQDYFRKFRRRKEKGLLGADAPTSTSSVLQAGL
RSLQDLGPEIRQALTYDTEEEEEEEEAAGQEAEEEEAENNPETYKDSIDSQPQAQWNSRI
SVSLPVKEKLPDSLSTGPSDDDGVAPNSRQPSGLQAGSQPHRRSSGVFMFTIPEEGSTQL
KGVQGQDNQNEEQEVPDWTPNLDEQAGMPSNPVLLPPHWSQQHVNGHHVPRRRLLPPTPA
GRKPSFTIQCLQRQGSCEDLPIPGTYHRGRTSGPGRAQGSWAAPPQKGRLLYAPLLLVEE
STVGEGYLGKLGGPLRTFTCLQVPGAPSDPSHRKRGSADSLVEAVLISEGLGLFAQDPRF
VALAKQEIADACHLTLDEMDSAASDLLAQRTTSLYSDEESILSRFDEEDLGDEMACVHAL
NT seq 5943 nt   +upstreamnt  +downstreamnt
atgtcggaatctgaagtcgggaaagacaccaccccagaacccagtccagccaatgggacc
ggtcctggccctgagtgggggctctgtcctgggcctccaaccgtggggactgataccagt
ggggcatcgggcctggggaccccaagacggaggactcagcacaacaagcacaagaccgta
gtggtggccagtgcgcagagatcacctcgagcactcttctgcctcaccttaaccaatccc
attcgtcggtcctgcatcagcattgtggagtggaagccatttgatattctcatcctcctg
accatctttgccaactgtgtggcattgggggtatatatccccttccctgaggacgactcc
aacactgctaaccacaacttggaacaggtagaatatgtgttcctggtgattttcaccgtg
gagacagtgctcaagatcgtggcctatgggctggtgctccatcccagcgcctacattcgc
aatggttggaacctactcgacttcatcatcgttgtagtcgggctgttcagcgtgttgctg
gagcagggacctgggcggccaggagatgccccgcatactggaggaaagccgggaggcttt
gatgtaaaggcactgcgggcatttagggtgctacgaccactaaggctagtgtctggggtc
ccgagtctgcacatagtgctcaattccatcatgaaggcgcttgtgccgcttctgcacatt
gccctgttggtgctcttcgtcattatcatttacgccatcatcggactcgagctgttcctc
ggacgaatgcacaagacgtgctacttcctgggatctgatatggaggcagaggaggacccg
tcgccttgtgcatcttctggctctggccgttcatgcacactgaaccagactgagtgccgt
gggcgctggccaggacccaacggtggcatcacgaactttgacaattttttctttgccatg
ctaactgtgttccagtgtattaccatggaaggctggacagacgtcctctactggatgcag
gatgccatggggtatgagctaccttgggtgtactttgtgagcctcgtcatctttgggtct
ttctttgtcctcaaccttgtgcttggagtcctaagtggggagttctccaaggaaagagaa
aaggcaaaagcccgaggtgactttcagaagcttcgggagaagcagcagatggaagaggac
cttcggggctacctggactggatcacacaggctgaggagttggaccttcatgacccctca
gtagacggcaacttggcttctcttgctgaagagggacgggcaggccatcgaccacaactg
tcagagctgaccaataggaggcgcggacgactgcgttggttcagccactccactcgctcc
acacactccaccagcagtcatgccagccttccagccagtgacactggttccataacagac
acccccggagatgaggatgaagaggaggggaccatggccagctgtacactctgcctaaac
aagattatgaaaaccaaggtctgccgccacttccgccgagccaaccgtggtctccgtgca
cgctgccgccgggcagtcaagtccaatgcctgctactgggctgtattgctgctcgtcttc
ctcaacacgttgaccatcgcttctgagcaccatgggcagccagtgtggctcacccagacc
caagaatatgccaacaaggttctgctctgcctcttcaccgtggagatgcttctcaaactg
tacggcctgggcccctctgtctacgttgcctcttttttcaaccgctttgactgtttcgtg
gtctgtgggggcatcctagaaacgacgttggtggaggtgggggccatgcagcccctcggc
atctcagtgctccgatgtgtgcgtctcctcaggatcttcaaggtcaccaggcactgggca
tccctcagcaatctggtggcatcgctgctcaactccatgaagtccatcgcctccttgctg
cttctcctctttctctttatcatcatcttctcccttcttggcatgcagctgtttgggggc
aagttcaactttgaccagacccacactaagagaagcacctttgataccttcccccaagcc
ctcctcaccgtctttcagatcctgactggtgaggattggaatgtagtcatgtatgacggt
atcatggcctacggtggtcccttcttcccagggatgctggtgtgtgtttatttcatcatc
ctcttcatctgtggcaactacatcctactgaacgtgtttcttgccattgctgtggataac
ctagccagcggggatgcgggtgctgccaaagataagggcagagagaagagcagtgaagga
aaccctccccaagagaacaaagtattggtgcctggtggagaaaatgaggacacagagggc
acaaaaagtgaaggagcagcaccaggcatggaggaagaggaggaagaagaggaggaggag
gaggaagaaaatggtgcaggacatgtggaactcctgcaggaagttgtacccaaggagaag
gtggtacccatccctgaaggcagtgccttcttctgcctcagccaaaccaacccgcttcgc
aaggcctgccacactctcatacaccatcacgtgttcaccagtctcatcctggtgttcatc
atcctcagtagtgtgtccctggctgctgaggaccccatcagagcccactccttccgcaac
catattctggggtacttcgattatgccttcacttccattttcaccgtggagattctatta
aagatgacggtgtttggggctttcctgcaccaaggttctttctgccgtagctggttcaat
ctgttggatctgcttgtggtcagtgtgtccctcatctcctttggcatccactccagtgcc
atctcagttgtgaagattctccgagtcctccgagtcctgcggcctctccgagccattaac
cgagccaagggactcaagcatgtggtgcagtgtgtgtttgtggccatccggaccattgga
aacatcatgattgtcaccaccctcttgcagttcatgttcgcctgcattggtgttcagctg
ttcaagggaaaattctacagttgcactgatgaagccaaacacaccctgaaagaatgcaag
ggctccttcctcatctaccctgatggagatgtgtcacgacctttggtccgggaacgcctc
tgggtcaacagtgatttcaactttgacaacgtcctttcagccatgatggccctgttcact
gtctctacctttgaaggctggcctgcgctactatacaaagccatagatgcacacgctgaa
gacgagggccctatctacaattaccatgtggagatatcagtattcttcattgtctacatc
atcatcatcgccttcttcatgatgaacatctttgtgggatttgtcatcatcacattccgt
gcccagggagagcaggaatatcaaaactgtgaactggacaagaaccagcgccagtgtgtg
gaatatgcactcaaagctcagccactccgccgatacatccccaagaatccacatcagtac
cgcgtgtgggccacagtgaactcagccgcctttgagtacctcatgtttctgctcatcctc
ctcaacacagttgccctggccatgcagcactatgagcagacggctccctttaactatgcc
atggacatactcaacatggtcttcactggcctcttcaccgttgagatggtgctcaaaatc
attgcctttaaacccaagcattactttgccgatgcctggaatacattcgatgctcttatt
gtagtgggcagcgtagtcgacattgccgtcacagaagtcaataatggaggccatcttggt
gagagctcagaggacagctcccgcatatctatcacgttctttcgcctcttccgggtcatg
aggctggtgaagctgctcagtaagggtgaggggatccgcacactgctctggacattcatc
aagtctttccaggccttgccctatgtggcacttcttatagcaatgatattcttcatatat
gcagtcattggcatgcagatgtttggcaaagtggctcttcaggacggcacacagataaat
cgaaacaataatttccagacctttccgcaggctgtgctgcttctgttcaggtgtgccact
ggtgaggcatggcaagagataatgctagccagccttccaggaaatcggtgtgaccctgag
tctgactttggcccaggcgaggaatttacctgtggtagcaattttgccattgtctacttt
atcagcttcttcatgctctgtgccttcctgattataaatctctttgtggctgtaatcatg
gataactttgattacctaaccagagattggtctattctgggaccccaccacctcgatgaa
ttcaagaggatctggtctgaatatgaccccggagccaagggccgcatcaagcacttggat
gtggttgccctgctgagacgcatccagcctccactgggatttggaaagctgtgcccacac
cgagtggcctgcaagagactggtggccatgaatgttcccctcaactcagacggaacagtg
acattcaacgcgacactctttgccctggtgcggacatccctgaggatcaagacagaaggg
aacctggatcaagccaaccaggagcttcggatggtcatcaaaaagatctggaagcggata
aagcagaaattgttagatgaggtcatcccccctccagatgaggaggaggtcactgtggga
aaattctatgccacatttctcatccaagattatttccgaaaattccggagaaggaaagaa
aaggggctactaggagcagatgccccaacaagcacatcctctgtcctccaggctggtcta
aggagcctacaggacttgggtcctgagatccgacaggccctcacctatgacactgaggaa
gaagaagaagaagaagaggccgcaggtcaggaagctgaggaggaggaagctgagaacaac
ccagaaacatacaaagactccatagactcccagccccaagctcaatggaactcgaggatt
tcggtgtctctaccagttaaggagaaactcccagattctctttcaactgggcctagtgat
gatgatggagtggctcccaactccaggcaacccagtgggctacaggctggatcccaaccc
cacaggagaagctctggggttttcatgttcactatcccagaagaaggaagtactcagctc
aagggagttcaagggcaagacaatcagaatgaggaacaggaagtccctgactggaccccc
aacctggatgagcaggcagggatgccctccaacccagtccttttaccacctcactggtcc
cagcaacatgtaaatgggcaccatgtaccacgccgacgtttgctaccccccacgcctgca
ggtcggaagccctccttcaccatccagtgtctgcaacgccagggcagttgtgaggatttg
cccatcccaggcacctaccatcgtggacggacctcaggaccaggcagggctcagggttcc
tgggcagcccctcctcagaagggtcgactgctctatgcccccctgttgctggtggaggaa
tctacagtgggtgaaggataccttggcaagctcggcggcccactgcgtaccttcacttgt
ctgcaagtgcctggagctccttcagatcccagtcaccgcaagaggggcagtgctgacagt
ttggtggaggctgtgcttatctccgaaggcctaggcctctttgcccaagacccacgattt
gtggccctggccaagcaagagattgcagatgcatgtcacctgaccctggatgagatggac
agtgctgccagtgacctgctggcacagagaaccacctccctttacagtgacgaggagtct
attctctcccgctttgatgaagaggacctgggagatgagatggcctgtgtccatgccctc
taa

KEGG   Rattus norvegicus (rat): 24239
Entry
24239             CDS       T01003                                 

Gene name
Cacna1c
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04742  Taste transduction
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04921  Oxytocin signaling pathway
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04929  GnRH secretion
rno04930  Type II diabetes mellitus
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno05010  Alzheimer disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05031  Amphetamine addiction
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24239 (Cacna1c)
   04020 Calcium signaling pathway
    24239 (Cacna1c)
   04024 cAMP signaling pathway
    24239 (Cacna1c)
   04022 cGMP-PKG signaling pathway
    24239 (Cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24239 (Cacna1c)
   04929 GnRH secretion
    24239 (Cacna1c)
   04912 GnRH signaling pathway
    24239 (Cacna1c)
   04921 Oxytocin signaling pathway
    24239 (Cacna1c)
   04935 Growth hormone synthesis, secretion and action
    24239 (Cacna1c)
   04924 Renin secretion
    24239 (Cacna1c)
   04925 Aldosterone synthesis and secretion
    24239 (Cacna1c)
   04927 Cortisol synthesis and secretion
    24239 (Cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    24239 (Cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    24239 (Cacna1c)
   04270 Vascular smooth muscle contraction
    24239 (Cacna1c)
  09156 Nervous system
   04724 Glutamatergic synapse
    24239 (Cacna1c)
   04727 GABAergic synapse
    24239 (Cacna1c)
   04725 Cholinergic synapse
    24239 (Cacna1c)
   04728 Dopaminergic synapse
    24239 (Cacna1c)
   04726 Serotonergic synapse
    24239 (Cacna1c)
   04720 Long-term potentiation
    24239 (Cacna1c)
   04723 Retrograde endocannabinoid signaling
    24239 (Cacna1c)
  09157 Sensory system
   04742 Taste transduction
    24239 (Cacna1c)
  09159 Environmental adaptation
   04713 Circadian entrainment
    24239 (Cacna1c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24239 (Cacna1c)
   05020 Prion disease
    24239 (Cacna1c)
   05022 Pathways of neurodegeneration - multiple diseases
    24239 (Cacna1c)
  09165 Substance dependence
   05031 Amphetamine addiction
    24239 (Cacna1c)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    24239 (Cacna1c)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    24239 (Cacna1c)
   05414 Dilated cardiomyopathy
    24239 (Cacna1c)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    24239 (Cacna1c)
   04934 Cushing syndrome
    24239 (Cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    24239 (Cacna1c)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   24239 (Cacna1c)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Etmic-2 DUF4834
Other DBs
NCBI-GeneID: 24239
NCBI-ProteinID: NP_036649
RGD: 2245
Ensembl: ENSRNOG00000007090
UniProt: P22002 Q71QJ6 A0SLC4
Structure
PDB: 
1VYT

Position
4
AA seq 2170 aa
MIRAFAQPSTPPYQPLSSCLSEDTERKFKGKVVHEAQLNCFYISPGGSNYGSPRPAHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGGTTATRPPRALLCLTLKNPIRRACISIVEWKSFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIIDVPAEEDPSPCALETGHGRQCQNGT
VCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVI
FGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEDKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN
RFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAE
MLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKI
TRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFD
NFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLA
IAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEVMEKPAVEESKEEKIELKSIT
ADGESPPTTKINMDDLQPSENEDKSPHSNPDTAGEEDEEEPEMPVGPRPRPLSELHLKEK
AVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRN
HILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSA
INVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQL
FKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFT
VSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQ
EQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLIL
LNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKHYFCDAWNTFDALI
VVGSIVDIAITEVHPAEHTQCSPSMSAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLL
WTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLF
RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL
FVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGF
GKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIK
KIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALS
LQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYY
QSDSRSNFPQTFATQRPLHINKTGNNQADTESPSHEKLVDSTFTPSSYSSTGSNANINNA
NNTALGRFPHPAGYSSTVSTVEGHGPPLSPAVRVQEAAWKLSSKRCHSRESQGATVSQDM
FPDETRSSVRLSEEVEYCSEPSLLSTDILSYQDDENRQLTCLEEDKREIQPSPKRSFLRS
ASLGRRASFHLECLKRQKDQGGDISQKTALPLHLVHHQALAVAGLSPLLQRSHSPSTFPR
PRPTPPVTPGSRGRPLQPIPTLRLEGAESSEKLNSSFPSIHCSSWSEETTACSGGSSMAR
RARPVSLTVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDM
TIEEMENAADNILSGGAQQSPNGTLLPFVNCRDPGQDRAVVPEDESCVYALGRGRSEEAL
PDSRSYVSNL
NT seq 6513 nt   +upstreamnt  +downstreamnt
atgattcgggccttcgctcagccatccacacccccataccagccgctctccagttgcctg
tctgaggacacagagaggaagttcaagggcaaggtggtacacgaagctcaactcaactgt
ttctacatttctcctggaggttccaactatgggagcccacgcccagctcatgccaacatg
aatgccaatgcagctgcaggacttgcccccgagcacatccctactccaggggcagcactg
tcctggcaggcagccatcgatgccgcccggcaggccaagttaatgggcagtgctggcaat
gcgaccatctctaccgtcagttccacacagcggaagcggcagcagtatgggaaacccaag
aagcaggggggcacaactgccacacggccgccccgggctctgctctgcctgactctgaag
aaccccatcaggagggcatgcatcagcattgttgaatggaaatcatttgaaataattatt
ttattgacgatttttgccaattgtgtggccttagcaatctatattccctttccggaagat
gactccaacgccaccaactccaacctggaacgggtggagtatctcttcctcatcattttt
accgtggaagcatttttaaaagtgattgcctacggactactcttccaccccaacgcttac
ctccgcaacggttggaatttactagattttataatcgtggttgtagggctttttagtgca
attttagaacaagcaaccaaagctgacggggccaacgctctgggagggaaaggagcggga
ttcgatgtgaaggcactgagagctttccgtgtgcttcgtcccctgcggctggtgtctgga
gtcccaagtctccaggtggtcctgaactccatcatcaaggccatggtgcccctgctgcac
attgccctcctcgtgctcttcgtcatcatcatctatgccattatcggcctggagctcttc
atggggaagatgcacaagacctgctacaaccaggagggcataatagatgttccagcggaa
gaggatccctccccttgtgctttggagacaggccatgggcgacagtgtcagaacgggacc
gtgtgcaagcccgggtgggatgggcccaagcacggcatcaccaacttcgacaacttcgcc
ttcgccatgctgacggtgttccagtgtatcaccatggagggctggacagacgtgctgtac
tggatgcaagacgctatgggctatgagttgccctgggtgtattttgtcagtctggtcatc
tttggatcctttttcgttctaaatctggttctcggtgttttgagcggagagttttccaaa
gagagggagaaagccaaagctcgaggagacttccagaagcttcgtgagaagcagcagcta
gaagaagatctcaaaggctacctggactggatcacccaggcggaagacatagaccctgag
aatgaggacgagggcatggatgaagacaaaccccgaaacatgagcatgcccacaagtgag
actgagtctgtcaacaccgaaaacgtggctggaggtgacatcgagggtgaaaactgtgga
gcccggcttgcccaccggatctccaaatccaagttcagccgctactggcgccggtggaat
agattctgcagaagaaagtgccgtgccgcagttaagtccaatgtcttctactggctggtg
atcttcctggtgttcctcaacaccctcaccattgcctccgaacactacaaccagcctcat
tggctcacagaagtgcaagacacggccaacaaggccctcctggcccttttcacggcagaa
atgctcctgaagatgtacagcctgggtctgcaggcctactttgtatccctcttcaaccgc
tttgactgtttcattgtgtgcgggggcatcctggagaccatcctggtggagacgaagatc
atgtcgcccctgggcatctctgtgctgagatgtgtgcggctgctcaggattttcaagatc
accaggtactggaactccctgagcaacctcgtggcgtccttgctgaactcagtgcgctcc
atcgcctccctgctgctactcctcttcctcttcatcatcatcttctccctcctggggatg
cagctgtttggtggaaagttcaactttgatgagatgcagacccgtaggagcacgtttgat
aacttcccacagtctctcctcactgtgtttcagatcctgaccggggaggactggaattcg
gtgatgtatgatgggatcatggcttatggcggcccctcttttccagggatgttagtctgt
atttacttcatcatcctcttcatctgtggaaattatatcctactgaatgtgttcttggcc
attgcggtggacaacctggctgatgcggagagcctgacctctgcccaaaaagaggaagaa
gaagagaaggagagaaagaagctggccaggactgccagcccagaaaagaaacaggaggtg
atggagaaaccagcagtagaggagagcaaagaggagaaaattgagctgaagtccattaca
gcagatggagaatccccacccactaccaagatcaacatggatgacctccagcccagtgaa
aatgaggacaagagtccccactccaacccagacactgcaggtgaagaggatgaggaggag
cccgagatgcctgtgggcccacgcccccggcccctgtctgagctgcaccttaaggaaaag
gcagtccccatgccggaagccagtgcatttttcatcttcagcccaaacaacaggttccgc
ctgcagtgccaccgcattgtcaatgacacgatcttcaccaacctcatcctcttcttcatt
ctgctcagtagcatctccctggcggctgaggaccccgtccagcacacctccttcaggaac
cacattctgttttattttgacattgtttttaccaccattttcaccattgaaattgctcta
aagatgactgcttacggggctttcctgcacaagggctctttctgccgaaattacttcaat
atcctggacctgctggtggttagcgtgtccctcatctcctttggcattcagtccagcgcg
atcaacgttgtgaagattttaagagtgcttcgtgtcctcaggcccctgagggccatcaac
agggccaaggggctaaagcacgtcgttcagtgtgtgtttgtggccatccggaccattgga
aacattgtaattgtcaccactctgctgcagttcatgttcgcctgcattggggtccagctc
ttcaagggaaagctctatacctgttcggatagttccaaacagacggaggcagaatgcaag
ggtaactatataacatacaaagacggagaagttgaccaccccattatccagcctcgaagt
tgggagaacagcaagttcgactttgacaatgttctggcagccatgatggccctctttacc
gtctccaccttcgaggggtggccagagctgctgtaccgctccattgactcccacacagaa
gacaagggtcccatctacaactatcgtgtggagatctccatcttcttcatcatctacatc
atcatcattgccttcttcatgatgaacatcttcgtgggtttcgtcattgtcaccttccag
gagcagggggaacaagaatacaagaactgtgagctggacaagaaccagagacaatgtgtg
gaatatgccctcaaggcccgacccttgcgaaggtacatccccaagaaccagcaccagtac
aaagtgtggtacgtggtcaactccacctacttcgagtatctgatgttcgtcctcatcctg
ctcaacaccatctgcctggccatgcagcactacggccagagctgcctcttcaaaatcgcc
atgaatatactcaacatgcttttcactggcctcttcacggtggagatgatcctgaagctc
attgccttcaaacccaagcactatttctgtgatgcatggaatacatttgacgccttgatt
gttgtgggtagcattgttgatatagcaatcaccgaggtacacccagctgaacatacccaa
tgctctccctctatgagtgcagaggagaactcccgcatctccatcaccttcttccgcctc
ttccgggtcatgcgcctggtgaagctgctgagccgaggggaaggcatccggaccctgctg
tggaccttcatcaagtccttccaggccctgccctatgtggcccttttgattgtgatgctg
ttctttatctatgcagtgattgggatgcaggtatttgggaagattgccctgaatgacacc
acagagatcaatcggaacaacaacttccagacgttccctcaggctgtgctactgctcttc
aggtgcgccactggggaggcctggcaggatatcatgctagcctgtatgccaggcaagaag
tgtgctccagagtctgagcccagcaacagcacggaaggggagacaccctgtggcagcagt
ttcgctgtcttctacttcatcagcttctacatgctctgtgccttcctgatcatcaacctc
tttgtagctgttatcatggacaactttgactacctgactagggattggtctatccttggt
ccccatcacctggatgaattcaagagaatctgggccgaatatgaccctgaagccaagggt
cggatcaaacacttggatgtggtgaccctcctccgtcgaattcagcccccactgggtttt
gggaagttgtgtcctcaccgtgtggcctgcaaacgcctggtgtccatgaacatgcctctg
aacagtgatgggacggtcatgttcaatgctacactgtttgcccttgtcaggacagccctg
aggatcaaaacagaagggaacctagagcaagccaatgaggagctgagagccatcatcaag
aaaatctggaagaggaccagcatgaagctgttggaccaggtggtgccccctgcaggtgat
gacgaggtcacagtgggcaagttctatgccaccttcctgatccaagagtacttcaggaaa
ttcaagaagcgaaaagagcaggggctggtcggcaagccctcgcagaggaatgcactgtct
ctgcaggctggcttacgcaccttgcatgacattgggcctgagatccggagagccatctct
ggggatctgacggctgaggaggagctggacaaggctatgaaggaggcagtgtctgctgcc
tccgaagacgacatcttcaggagggctggaggcctgtttggcaaccacgtcagctactac
cagagtgacagcaggagcaacttccctcagacgtttgccacccaacgcccactgcacatc
aacaagacagggaacaaccaagcggacaccgaatcaccgtcccatgagaagctggtggac
tccactttcacccccagcagctactcatccacgggctccaatgccaacatcaacaatgcc
aacaacactgccctgggccgcttcccccaccctgctggctactccagcacggtcagcact
gtggagggccatgggcctcccttgtcccctgctgtccgggtacaggaggcagcatggaaa
ctcagctctaagaggtgccactcccgagagagccagggggccacggtgagtcaggatatg
tttccagatgagacccgcagcagcgtgaggctgagcgaagaagttgagtactgcagtgag
cccagcctgctctccacagatatactctcctaccaggacgatgaaaaccgacaactgacc
tgtctagaggaggacaagagggagatccagccatctccgaagaggagtttccttcgctct
gcctctctaggtcgaagggcctccttccatctggaatgtctaaagcgacaaaaggatcaa
gggggagacatctctcagaagacagccttgcccttgcatctggttcatcaccaggcattg
gcagtggcaggcttgagccccctcctgcagagaagccattctccttccacgttccccagg
ccacgccccacgccccctgtcactccaggcagccggggcaggcccctacagcccatccct
accctgcggctggagggggcggagtccagtgagaaactcaacagcagcttcccgtccatc
cactgcagctcctggtcagaggagaccacagcctgtagtgggggcagcagcatggcccgg
agagcccggcccgtctccctcaccgtgcccagccaggctggagctccaggcagacagttc
cacggcagcgccagcagcctggtggaagcggtcttgatttcagaaggactgggacagttt
gctcaagatcccaagttcatcgaggtcaccacacaggagctggctgacgcctgcgatatg
acaatagaggagatggagaacgccgcagacaacatcctcagcgggggcgcccagcagagc
cccaacggcaccctcttaccttttgtgaactgcagggacccagggcaggacagggctgtg
gtcccagaggacgagagctgtgtatatgccctggggcgaggccggagcgaggaagcgctc
ccggacagcaggtcctatgtcagcaacctgtag

KEGG   Rattus norvegicus (rat): 257648
Entry
257648            CDS       T01003                                 

Gene name
Cacna1b
Definition
(RefSeq) voltage-dependent N-type calcium channel subunit alpha-1B isoform 1
  KO
K04849  voltage-dependent calcium channel N type alpha-1B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04721  Synaptic vesicle cycle
rno04723  Retrograde endocannabinoid signaling
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04930  Type II diabetes mellitus
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05032  Morphine addiction
rno05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    257648 (Cacna1b)
   04020 Calcium signaling pathway
    257648 (Cacna1b)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    257648 (Cacna1b)
   04725 Cholinergic synapse
    257648 (Cacna1b)
   04728 Dopaminergic synapse
    257648 (Cacna1b)
   04726 Serotonergic synapse
    257648 (Cacna1b)
   04723 Retrograde endocannabinoid signaling
    257648 (Cacna1b)
   04721 Synaptic vesicle cycle
    257648 (Cacna1b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    257648 (Cacna1b)
   05020 Prion disease
    257648 (Cacna1b)
   05022 Pathways of neurodegeneration - multiple diseases
    257648 (Cacna1b)
  09165 Substance dependence
   05032 Morphine addiction
    257648 (Cacna1b)
   05033 Nicotine addiction
    257648 (Cacna1b)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    257648 (Cacna1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    257648 (Cacna1b)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   257648 (Cacna1b)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 257648
NCBI-ProteinID: NP_001182128
RGD: 628852
Ensembl: ENSRNOG00000004560
UniProt: E1AW38
Structure
PDB: 
4DEX

Position
3
AA seq 2354 aa
MVRFGDELGGRYGGTGGGERARGGGAGGAGGPGQGGLPPGQRVLYKQSIAQRARTMALYN
PIPVKQNCFTVNRSLFVFSEDNVVRKYAKRITEWPPFEYMILATIIANCIVLALEQHLPD
GDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFVFHKGSYLRNGWNVMDFVVVLTGILA
TAGTDFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAILMFAII
GLEFYMGKFHKACFPNSTDAEPVGDFPCGKEAPARLCDSDTECREYWPGPNFGITNFDNI
LFAILTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNLVLGVLSGEFA
KERERVENRRAFLKLRRQQQIERELNGYLEWIFKAEEVMLAEEDKNAEEKSPLDAVLKRA
ATKKSRNDLIHAEEGEDRFVDLCAAGSPFARASLKSGKTESSSYFRRKEKMFRFLIRRMV
KAQSFYWVVLCVVALNTLCVAMVHYNQPQRLTTALYFAEFVFLGLFLTEMSLKMYGLGPR
SYFRSSFNCFDFGVIVGSIFEVVWAAIKPGTSFGISVLRALRLLRIFKVTKYWNSLRNLV
VSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFQDETPTTNFDTFPAAILTVFQI
LTGEDWNAVMYHGIESQGGVSKGMFSSFYFIVLTLFGNYTLLNVFLAIAVDNLANAQELT
KDEEEMEEAANQKLALQKAKEVAEVSPMSAANISIAAFVKQTRGTVSRSSSVSSVNSPQQ
NSAKARSVWEQRASQLRLQNLRASCEALYSEMDPEERLRYASTRHVRPDMKTHMDRPLVV
EPGRDGLRGPAGNKSKPEGTEATEGADPPRRHHRHRDRDKTSASTPAGGEQDRTDCPKAE
STETGAREERARPRRSHSKEAPGADTQVRCERSRRHHRRGSPEEATEREPRRHRAHRHAQ
DSSKEGKEGTAPVLVPKGERRARHRGPRTGPRETENSEEPTRRHRAKHKVPPTLEPPERE
VAEKESNVVEGDKETRNHQPKEPRCDLEAIAVTGVGSLHMLPSTCLQKVDEQPEDADNQR
NVTRMGSQPSDPSTTVHVPVTLTGPPGEATVVPSANTDLEGQAEGKKEAEADDVLRRGPR
PIVPYSSMFCLSPTNLLRRFCHYIVTMRYFEMVILVVIALSSIALAAEDPVRTDSFRNNA
LKYMDYIFTGVFTFEMVIKMIDLGLLLHPGAYFRDLWNILDFIVVSGALVAFAFSGSKGK
DINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVLNILIVYMLFMFIFAVIAVQ
LFKGKFFYCTDESKELERDCRGQYLDYEKEEVEAQPRQWKKYDFHYDNVLWALLTLFTVS
TGEGWPMVLKHSVDATYEEQGPSPGFRMELSIFYVVYFVVFPFFFVNIFVALIIITFQEQ
GDKVMSECSLEKNERACIDFAISAKPLTRYMPQNKQSFQYKTWTFVVSPPFEYFIMAMIA
LNTVVLMMKFYDAPYEYELMLKCLNIVFTSMFSLECILKIIAFGVLNYFRDAWNVFDFVT
VLGSITDILVTEIAETNNFINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYV
CLLIAMLFFIYAIIGMQVFGNIALDDGTSINRHNNFRTFLQALMLLFRSATGEAWHEIML
SCLGNRACDPHANASECGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILG
PHHLDEFIRVWAEYDPAACGRISYNDMFEMLKHMSPPLGLGKKCPARVAYKRLVRMNMPI
SNEDMTVHFTSTLMALIRTALEIKLAPAGTKQHQCDAELRKEISSVWANLPQKTLDLLVP
PHKPDEMTVGKVYAALMIFDFYKQNKTTRDQTHQAPGGLSQMGPVSLFHPLKATLEQTQP
AVLRGARVFLRQKSATSLSNGGAIQTQESGIKESLSWGTQRTQDVLYEARAPLERGHSAE
IPVGQPGALAVDVQMQNMTLRGPDGEPQPGLESQGRAASMPRLAAETQPAPNASPMKRSI
STLAPRPHGTQLCNTVLDRPPPSQVSHHHHHRCHRRRDKKQRSLEKGPSLSVDTEGAPST
AAGSGLPHGEGSTGCRRERKQERGRSQERRQPSSSSSEKQRFYSCDRFGSREPPQPKPSL
SSHPISPTAALEPGPHPQGSGSVNGSPLMSTSGASTPGRGGRRQLPQTPLTPRPSITYKT
ANSSPVHFAEGQSGLPAFSPGRLSRGLSEHNALLQKEPLSQPLASGSRIGSDPYLGQRLD
SEASAHNLPEDTLTFEEAVATNSGRSSRTSYVSSLTSQSHPLRRVPNGYHCTLGLSTGVR
ARHSYHHPDQDHWC
NT seq 7065 nt   +upstreamnt  +downstreamnt
atggtccgcttcggggacgagctaggcggccgctatgggggcaccggcggcggggagcgg
gctcggggcggcggggccggcggggccggtggcccgggccaggggggtctgccgccgggc
cagcgggtcctgtacaagcagtccattgcgcaacgcgcacggaccatggccctgtacaac
cccatcccagtcaagcagaactgcttcaccgtcaaccgctcgctcttcgtcttcagcgag
gacaacgtcgtccgcaaatatgctaagcgcatcaccgaatggccgcccttcgaatatatg
atcctggccaccatcatcgccaactgtattgtcctggccctggagcagcacctccctgat
ggggacaagactcccatgtctgaacgactggatgacacggaaccttacttcatcggcatc
ttttgcttcgaggcgggcatcaagatcatagctctgggcttcgtgttccacaaaggctcc
tacctccggaatggctggaacgtcatggacttcgtggtggtcctcacagggattcttgcc
acagctggaactgactttgatctgcgcaccctgagggctgtgcgtgtgcttaggcccctg
aagttggtgtctggaattccaagcttgcaggtggtgctcaagtccatcatgaaggccatg
gtcccgctgctgcagatcgggctgctgctcttcttcgccatcctcatgttcgctatcatc
ggcctcgagttctatatgggcaaattccataaggcctgcttccccaacagcacagatgca
gagcctgtgggtgactttccttgtggcaaggaggcccctgctcgtctgtgtgacagtgac
accgaatgccgggagtactggccaggacccaactttggcatcaccaattttgacaacatc
ctgtttgccatcttgaccgtgttccagtgtatcaccatggagggctggactgacatcctc
tacaatacaaatgatgcggccggcaacacgtggaactggttgtacttcatccccctcatc
atcattggctccttcttcatgctcaacctggtgctcggtgtgctttcaggagagtttgcc
aaagagcgggagcgagtcgagaaccgccgtgccttcctgaagctccgcaggcagcagcag
attgagcgagaactgaatgggtacttggagtggatcttcaaggcggaggaagtcatgttg
gcagaggaggacaagaacgcagaagagaagtcccctttggatgcagtgttgaagagagct
gctaccaagaagagccgaaatgacctcatccatgcagaagagggggaggaccggtttgta
gacctctgtgctgctgggtctccctttgctcgtgccagcctcaagagtgggaagacagag
agctcatcgtacttccggaggaaggagaagatgttccggttccttatccgtcgtatggtg
aaagcacagagcttctactgggtggtactgtgcgtggtggccctgaacacgttgtgtgtg
gccatggtacactataatcagcctcagcggcttaccactgcactgtactttgcagagttt
gttttcctgggtctcttcctcacagagatgtccctgaagatgtacggtctagggcccaga
agctacttccggtcttccttcaactgctttgactttggggtgattgtggggagtatcttt
gaagtagtctgggctgccatcaagccaggaacctccttcggaatcagtgtgctgcgggct
ctccgactgctgaggattttcaaagtcaccaagtattggaactccctgaggaacctggtt
gtttccctcctcaactccatgaagtccatcatcagccttctcttcctgcttttccttttc
attgtggtcttcgctctgttggggatgcagctgtttgggggacagttcaactttcaagat
gagactccaaccaccaattttgataccttcccagctgccatcctcactgtgtttcagatt
ctgacaggagaggactggaatgcagtcatgtatcatgggattgagtcacaaggaggagtc
agcaaaggcatgttttcatccttttacttcatcgtcctgacactgtttggaaactacacc
ctgttgaacgttttcttggccattgctgtggacaaccttgccaatgcccaggagttgacc
aaggatgaagaggagatggaagaggcagccaatcagaagcttgctcttcagaaggccaaa
gaagtagctgaagtcagccccatgtctgctgccaacatctccattgctgcttttgtaaag
caaactcgaggtactgtatctcgcagctcatctgtctccagcgtaaactcaccgcagcag
aactcggccaaggcgcgctcagtatgggagcagcgggccagtcagctaaggctccagaac
ctgcgtgccagctgtgaggcactgtacagtgagatggacccggaggagcgcctgcgttat
gccagcacgcgccacgtgaggccagacatgaagacacacatggaccgacccctagtggtg
gaacctggtcgggatggcctgcggggacccgccgggaacaagtcaaagcctgagggcacg
gaggccaccgaaggtgcggatccaccacgccgacaccaccggcatcgtgatagggacaag
acctcagcctcaacccctgctggaggcgaacaggacaggacagactgcccaaaggccgaa
agcaccgagaccggggcccgggaggaacgtgcgcgccctcgtcgaagtcacagcaaggag
gctccaggggctgacacacaagtgcgttgtgagcgcagtagacgtcaccaccggcgcgga
tccccggaggaggccactgaacgggaacctcggcgccaccgtgcccaccggcacgcacag
gactcaagcaaggaaggcaaggagggcactgcaccggtgcttgtacccaagggcgagcgt
cgcgcaagacatcgaggcccgcgtacgggcccccgtgagacagagaacagtgaggagccc
acacgcaggcaccgtgcaaagcataaggtgccaccaacacttgagcccccagagagggag
gttgcagagaaggagagcaacgtggtggaaggggataaggaaactcgaaatcaccagccc
aaggaacctcgctgtgacctggaggccattgcggttacaggcgtgggctctctgcacatg
ctgcccagcacctgtctccagaaagtggacgaacagccagaggatgcagacaaccagcgt
aatgtcacccggatgggcagtcagccctcagaccccagcaccactgtgcatgtcccagtg
acactgacaggccctcccggggaggccactgtagttcccagtgctaacacggacctggaa
ggccaagcggagggcaagaaggaggcagaggctgacgatgtgctgagaagaggccccagg
cccatcgttccctacagttccatgttctgcctcagccccaccaacctactccgtcgcttc
tgccattacattgtgaccatgcggtactttgagatggtgattcttgtggtcatcgccttg
agcagcattgccctggctgctgaggatcccgtgcggaccgactcattccggaacaatgct
ctgaagtacatggactacatctttacaggagtcttcacctttgagatggtcataaagatg
atagacttgggcctgctgctgcaccctggggcctacttccgggacctgtggaacattctg
gacttcattgttgtcagtggagccctggtggcatttgcattctcaggatccaaagggaaa
gacatcaataccatcaagtctctgagagtcctgcgagtcctgcggcccctcaagaccatc
aagcggctgcctaaactcaaggctgtgtttgactgtgtggtgaactctctgaagaatgtc
ttgaacatcctgatcgtctacatgctcttcatgtttatatttgccgtcatcgccgtccaa
ctcttcaaagggaagttcttttactgcactgatgagtccaaggagctggagcgggactgc
aggggtcagtatttggattatgagaaggaagaggtagaagcccagccaaggcagtggaag
aaatatgacttccactatgacaatgtgctctgggccttgctgactctgtttacggtgtcc
acaggagaggggtggcccatggtgctgaaacactctgtggacgccacctatgaggagcag
gggccaagccccgggtttcggatggagctttccatcttctatgtggtctactttgtggtc
ttcccttttttctttgtcaacatctttgtggccttgatcatcatcaccttccaggagcag
ggggacaaggtgatgtctgagtgcagtctggaaaagaatgagagggcttgcattgacttt
gccatcagcgccaaacccctgacacggtacatgcctcagaacaagcagtcgttccagtat
aagacatggacatttgtggtctctccaccctttgagtacttcattatggccatgatagcc
ctcaacacagtggtgctgatgatgaagttctacgatgccccttatgagtacgagctgatg
ctgaagtgcttgaacatcgtcttcacatccatgttctctctggagtgcatcctgaagatc
atcgccttcggggtgttgaactacttcagagatgcctggaacgtctttgactttgtcact
gttttgggaagtattactgatattttagtaacggagattgcggaaacgaacaacttcatc
aacttgagcttccttcgcctcttccgggcagcacggctgatcaagctgcttcgccagggc
tacaccatccgcatcttgttatggacctttgtccagtcctttaaggcgctgccctacgtg
tgcctcctcattgccatgctgttcttcatctacgccatcatcggcatgcaggtttttgga
aacattgcccttgatgatggcaccagcatcaaccgacacaacaacttccggacatttctg
caagccttaatgctgttgttcaggagtgccactggggaggcctggcacgaaatcatgctg
tcttgcctgggcaaccgggcctgcgacccacatgccaacgccagcgaatgcgggagcgac
tttgcctatttttattttgtctccttcatcttcctctgttcctttctgatgctgaacctc
tttgttgctgtgatcatggacaatttcgaatacctcacgcgggattcttccatcctaggg
ccgcaccacctcgatgaattcattcgcgtctgggctgaatacgacccagctgcgtgtggg
cgcatcagttacaatgacatgtttgagatgctgaaacacatgtccccacctctgggtttg
gggaagaaatgcccggctcgagttgcatacaagcgcctggttcgaatgaacatgcccata
tccaatgaggacatgacggtacactttacatccacactgatggccctcatccggacggca
ctggagatcaagcttgccccagcggggacaaaacagcaccaatgtgatgctgagctgagg
aaggagatctcttctgtgtgggctaatctgccccagaagactctggacttactggtgcca
ccccacaaacctgacgagatgacagtggggaaggtctatgcggctctcatgatatttgac
ttctacaaacagaacaaaaccaccagagatcagactcaccaagctcctggaggcctgtcc
cagatgggtcctgtttccctgttccatcctctgaaggccaccctggagcagacacagccc
gctgtgctccgaggagctcgggttttccttcgacaaaagagtgcaacttccctcagcaat
gggggcgccatacaaacccaggaaagtggcatcaaggagtccctgtcctggggcacgcag
aggacccaggacgtactttatgaggccagagcacctctagaacgtggccattctgcagag
atccctgtggggcagccaggagcactggctgtagatgtccagatgcagaacatgacattg
agaggaccggatggggagccccagcctggcctggagagccaaggccgagcggcctctatg
ccacgcctggcggcagaaacacagccggcccctaatgccagccccatgaagcgctccatc
tccacactggctccacgcccgcatgggactcagctttgcaacacagtcctggaccggcca
cctcctagccaggtgtcccatcaccaccaccaccgctgccaccggcgcagggacaagaag
cagaggtccctggaaaaggggcccagcctgtctgttgacacagaaggtgcaccaagtact
gctgcaggatctggcctgccccatggagaagggtccacaggctgccggcgggagcgtaag
caagagcgaggccggtcccaggagcggaggcagccctcctcctcttcttcagagaagcag
cgcttctattcctgtgaccgctttgggagccgggagcccccacaacctaagccctccctc
agtagccaccccatatcgccaacagcggcactagagccaggaccccacccgcagggcagt
ggttccgttaatgggagccccttgatgtcaacatctggtgctagcacgccgggccgaggt
gggcggaggcagctcccccagactcccctgaccccacgccccagcatcacctacaagacg
gccaattcctcgcctgtccactttgctgagggtcagagtggccttccagccttctcccct
ggccgtctcagccgcggcctttctgaacacaatgccctgctccagaaagagcccctgagc
cagcctctagcttctggctcccgcattggctctgacccttacctagggcagcgtctggac
agtgaggcctctgcccacaacctgcctgaggatacactcacctttgaagaggccgtggcc
accaactctggccgctcctccaggacttcctatgtgtcctccctcacttcccaatcccac
cctctccgccgtgtacccaatggctaccactgcactttgggactcagcaccggcgtccgg
gcgcggcacagctaccaccacccagaccaggatcactggtgctag

KEGG   Rattus norvegicus (rat): 29716
Entry
29716             CDS       T01003                                 

Gene name
Cacna1d
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1D
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04218  Cellular senescence
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04530  Tight junction
rno04713  Circadian entrainment
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04921  Oxytocin signaling pathway
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04929  GnRH secretion
rno04930  Type II diabetes mellitus
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04973  Carbohydrate digestion and absorption
rno05010  Alzheimer disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05031  Amphetamine addiction
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29716 (Cacna1d)
   04020 Calcium signaling pathway
    29716 (Cacna1d)
   04024 cAMP signaling pathway
    29716 (Cacna1d)
   04022 cGMP-PKG signaling pathway
    29716 (Cacna1d)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    29716 (Cacna1d)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    29716 (Cacna1d)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    29716 (Cacna1d)
   04929 GnRH secretion
    29716 (Cacna1d)
   04912 GnRH signaling pathway
    29716 (Cacna1d)
   04921 Oxytocin signaling pathway
    29716 (Cacna1d)
   04935 Growth hormone synthesis, secretion and action
    29716 (Cacna1d)
   04924 Renin secretion
    29716 (Cacna1d)
   04925 Aldosterone synthesis and secretion
    29716 (Cacna1d)
   04927 Cortisol synthesis and secretion
    29716 (Cacna1d)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    29716 (Cacna1d)
   04261 Adrenergic signaling in cardiomyocytes
    29716 (Cacna1d)
   04270 Vascular smooth muscle contraction
    29716 (Cacna1d)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    29716 (Cacna1d)
  09156 Nervous system
   04724 Glutamatergic synapse
    29716 (Cacna1d)
   04727 GABAergic synapse
    29716 (Cacna1d)
   04725 Cholinergic synapse
    29716 (Cacna1d)
   04728 Dopaminergic synapse
    29716 (Cacna1d)
   04726 Serotonergic synapse
    29716 (Cacna1d)
   04723 Retrograde endocannabinoid signaling
    29716 (Cacna1d)
  09159 Environmental adaptation
   04713 Circadian entrainment
    29716 (Cacna1d)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29716 (Cacna1d)
   05020 Prion disease
    29716 (Cacna1d)
   05022 Pathways of neurodegeneration - multiple diseases
    29716 (Cacna1d)
  09165 Substance dependence
   05031 Amphetamine addiction
    29716 (Cacna1d)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    29716 (Cacna1d)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    29716 (Cacna1d)
   05414 Dilated cardiomyopathy
    29716 (Cacna1d)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    29716 (Cacna1d)
   04934 Cushing syndrome
    29716 (Cacna1d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29716 (Cacna1d)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   29716 (Cacna1d)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel Rer1
Other DBs
NCBI-GeneID: 29716
NCBI-ProteinID: NP_001376154
RGD: 70973
Ensembl: ENSRNOG00000013147
Structure
PDB: 
1VYT

Position
16
AA seq 2164 aa
MMMMMMMKKMQHQRQQQEDHANEANYARGTRLPISGEGPTSQPNSSKQTVLSWQAAIDAA
RQAKAAQTMSTSAPPPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACI
SIVDWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKI
IAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKT
CFFADSDIVAEEDPAPCAFSGNGRQCAANGTECRSGWVGPNGGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRNTSMPTSETESVNTENVS
GEGETQGCCGSLWCWWKRRGAAKTGPSGCRRWGQAISKSKLSRRWRRWNRFNRRRCRAAV
KSVTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQ
AYFVSLFNRFDCFVVCGGITETILVELELMSPLGVSVFRCVRLLRIFKVTRHWTSLSNLV
ASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQ
ILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAES
LNTAQKEEAEEKERKKIARKESLENKKNNKPEVNQIANSDNKVTIDDYQEEAEDKDPYPP
CDVPVGEEEEEEEEDEPEVPAGPRPRRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCH
KLINHHIFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMTT
FGAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKG
LKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFI
LYKDGDVDSPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVGP
VYNYRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYAL
KARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDIL
NMVFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSIIDVALSEADNSEESNRISI
TFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKV
AMRDNNQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKLCDPDSDYNPGEEYTC
GSNFAIVYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPE
AKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVR
TALKIKTEGNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDY
FRKFKKRKEQGLVGKYPAKNTTIALQAGLRTLHDIGPEIRRAISCDLQDDEPEDSKPEEE
DVFKRNGALLGNYVNHVNSDRRESLQQTNTTHRPLHVQRPSIPPASDTEKPLFPPAGNSV
CHNHHNHNSIGKQVPTSTNANLNNANMSKAAHGKRPSIGDLEHVSENGHYSYKHDRELQR
RSSIKRTRYYETYIRSESGDEQLPTICREDPEIHGYFRDPRCFGEQEYFSSEECCEDDSS
PTWSRQNYSYYNRYPGSSMDFERPRGYHHPQGFLEDDDSPIGYDSRRSPRRRLLPPTPPS
HRRSSFNFECLRRQNSQDDVLPSPALPHRAALPLHLMQQQIMAVAGLDSSKAQKYSPSHS
TRSWATPPATPPYRDWTPCYTPLIQVDRSESMDQVNGSLPSLHRSSWYTDEPDISYRTFT
PASLTVPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVSATKHEIADACDLTID
EMESAASTLLNGSVCPRANGDMGPISHRQDYELQDFGPGYSDEEPDPGREEEDLADEMIC
ITTL
NT seq 6495 nt   +upstreamnt  +downstreamnt
atgatgatgatgatgatgatgaaaaaaatgcagcatcaacggcagcagcaagaggaccac
gcgaacgaggcaaactatgcaagaggcaccagactccctatttctggtgaaggaccaact
tctcagccgaacagctccaagcaaaccgtcctgtcttggcaagctgcaattgatgctgct
agacaggccaaggccgcccagaccatgagcacgtctgcacccccacctgtaggatctctc
tcccaaagaaaacgtcagcaatacgccaagagcaaaaaacagggtaactcgtctaacagc
cgacctgcccgtgccctcttctgtttatccctcaataaccccatccgaagagcctgcatt
agtatagtggattggaaaccatttgacatatttatattattggctatttttgccaattgt
gtggccttagctatttacatcccgttccctgaagatgattctaattcaacaaatcataac
ttggaaaaagtagaatatgccttcctgattatttttacagtggagacatttctgaagatt
atagcgtacggactgctgctgcatcctaatgcttacgttaggaacggatggaacttactg
gattttgttatagtaatagtaggattgtttagtgtaattttggaacaattaaccaaagaa
acagaaggcgggaaccactctagtggcaaatcaggaggctttgatgtcaaagccctccgt
gccttccgagtgttaagaccgcttcgacttgtatcaggagtgcccagtttacaagttgtt
ctgaactccattataaaagccatggtccccctcctccacatagcccttttggtgttattc
gtaattatcatctatgcgattatagggttggaactttttattggaaaaatgcacaaaacc
tgtttttttgctgactcagatatagtagctgaagaggacccagctccatgcgcgttctca
gggaatggacgccagtgtgccgccaatggcacggaatgtaggagcggctgggtcggcccc
aatggaggcatcactaattttgacaactttgcctttgccatgctcactgtgttccagtgc
atcaccatggagggctggacagatgtgctctactgggttaatgatgcgataggatgggag
tggccatgggtgtattttgttagtctgatcatccttggctcatttttcgtccttaacctg
gttcttggtgtccttagtggagaattctcaaaggaaagagagaaggctaaagcacgtgga
gatttccagaagcttcgggagaagcagcagctggaagaggatctcaagggctacttggac
tggatcacccaggcagaagacatagatcctgagaatgaagaggagggtggagaggagggc
aaacgaaacactagcatgcccaccagtgagaccgaatctgtgaacacagagaacgtaagt
ggtgaaggcgagacccagggatgctgtggaagtctctggtgctggtggaaaagaagaggc
gcggccaagactgggccctctgggtgtcggcggtggggccaagccatctcaaaatccaag
ctcagccgtcggtggcgtcgctggaaccggttcaatcgcaggagatgcagggcagctgtg
aagtctgtcacgttttactggctggtgatcgttctggtgtttctcaacactctgacgatt
tcctctgagcattacaatcagccagactggctgacgcagattcaagatatagcgaacaaa
gtgctcttggctttgttcacctgtgagatgctggtgaagatgtacagcctgggcctccag
gcctacttcgtctctctcttcaaccgcttcgattgctttgtggtgtgtgggggaatcacc
gaaaccatcctggtggaactggagctcatgtctcccctgggcgtctctgtgttccggtgt
gtacgtctcctgaggatcttcaaagtgaccaggcactggacttccctgagcaacttggtg
gcgtccctgttaaactccatgaagtccatcgcctctctgctgttgctgctcttcctcttc
atcatcatcttctccctgctgggaatgcagctgttcggagggaagttcaatttcgatgag
acacagaccaagcgaagcaccttcgacaacttcccacaggcgctcctgactgtgttccag
atcctgacgggcgaagactggaatgcggtgatgtatgacggcatcatggcctacggaggc
ccgtcctcctctggaatgattgtctgtatttacttcatcatccttttcatctgtggtaac
tatatcctgctgaacgtcttcttggccattgctgtagacaatttggctgatgctgaaagt
ctgaacactgctcagaaagaggaagccgaagaaaaagaaaggaaaaaaattgccagaaaa
gaaagcctagaaaacaaaaaaaacaacaaaccagaggtcaaccagatagccaacagtgac
aacaaggttactattgatgactatcaagaggaggctgaagataaggacccttatccaccc
tgcgatgtgccagtaggtgaagaggaagaggaggaggaagaggacgagcctgaggttcct
gctggtccccgtcctcgaagaatctcagagttgaacatgaaggagaaaattgcacccatc
cccgaaggaagcgcattcttcattcttagcaagaccaacccgatccgtgtgggttgccac
aaactcatcaaccaccacatcttcaccaacctcatcctggtcttcatcatgctgagcagc
gctgccctggccgcagaggatcccatccgcagccactccttccgcaacactatactgggc
tactttgactatgctttcacagccatctttacggttgaaatcctgttaaagatgacaact
tttggagcgttcttgcacaaaggggctttctgtaggaactacttcaatttgctggacatg
ctggtcgttggggtgtctctggtgtcatttgggattcaatccagtgccatctcggttgtg
aagattctgagggtcttaagggtcttgaggcctctcagagcaatcaacagagcaaaagga
cttaagcacgtggtccagtgtgtctttgtggccatccgaaccatcggcaacatcatgatc
gtcacgaccctgctccagttcatgtttgcttgcattggggtccagctgttcaaggggaag
ttctaccgttgcacagatgaggccaaaagtaaccccgaggagtgcagggggcttttcatc
ctttataaggacggcgatgtcgacagtcccgtggtccgtgagaggatctggcaaaacagt
gatttcaatttcgacaatgtcctttcggctatgatggcgctcttcacggtctcgactttt
gagggctggcccgcgttgctgtacaaagctatcgactcaaacggagagaacgttggtcct
gtctacaactaccgtgtggagatctccatcttcttcattatctacatcatcatcgtggcc
ttcttcatgatgaatatcttcgtgggcttcgtcatcgtcaccttccaggagcagggagaa
aaggagtataagaactgtgagctggacaaaaatcagcgtcagtgtgtggaatatgccttg
aaggcccgccccttaaggagatacatccccaaaaacccataccagtacaagttctggtac
gtggtgaactcctcgcctttcgaatatatgatgtttgtcctcatcatgctcaacacgctc
tgcctggccatgcagcactatgagcaatccaagatgttcaatgacgccatggacattctg
aacatggtcttcacgggggtcttcaccgttgagatggttttgaaagtcatcgcatttaag
cccaaggggtattttagtgacgcctggaacacgtttgactccctcatcgtaatcggcagc
attatagacgtggcactcagcgaagctgacaactctgaagagagcaatagaatctccatc
acctttttccgtcttttccgagtgatgcggttggtgaagcttctcagcagaggggaaggc
atccggactctgctatggaccttcattaagtccttccaggcactcccatatgtcgccctc
ctcattgccatgctcttcttcatctacgccgtcattggcatgcagatgtttgggaaggtt
gccatgagagataacaaccagatcaataggaacaacaacttccagacgtttccccaggca
gtgctgctgctcttcaggtgtgcaacaggggaggcctggcaggagatcatgctcgcctgc
ctccctgggaagctgtgtgacccggactcagattacaacccaggagaggaatatacttgt
gggagcaactttgccattgtctacttcatcagcttttacatgctctgtgcgttcctgatc
atcaacctcttcgtggctgtcatcatggacaattttgactatctgacgagggactggtct
attctggggcctcaccacttggacgaattcaaaagaatatggtctgaatatgaccccgag
gcaaagggaaggataaaacaccttgatgtggtcactttgctccgacgtatccagcctccc
ctgggatttggaaagttgtgtccacaccgagtggcgtgtaagagattggtcgccatgaac
atgcctctcaacagtgatgggacagtcatgttcaatgcaactctgtttgctttggtacgg
acggctctcaagatcaagactgaaggcaacctggagcaagctaatgaagagctccgcgct
gtgataaagaaaatctggaagaagacaagcatgaagctacttgaccaagttgtccctcca
gctggtgatgatgaggtaaccgtggggaagttctatgccactttcctgatacaggactac
tttaggaaattcaagaagcggaaagagcaaggcctggtggggaaataccctgcgaagaac
accacgatcgccctacaggcgggattaaggaccctgcatgacattgggccagaaatccga
cgggctatatcctgtgacttgcaagatgacgaaccagaagactccaaaccagaagaggaa
gatgtattcaaaagaaatggtgccctgcttggaaactatgtcaatcatgttaatagtgat
aggagagagtcccttcagcagaccaataccacccaccgtcccctgcatgtccaaaggcct
tcaattccacctgcaagtgatactgagaaaccgctgtttcctccagcaggaaattcggtg
tgtcataaccatcataaccataattccatagggaagcaagttcccacctccacaaatgcc
aatctcaataacgccaatatgtccaaagctgcccacggaaagcggcccagcattggggac
cttgagcatgtgtctgaaaacggccattactcctacaagcacgaccgagagcttcaaaga
aggtccagtattaaaagaacccgctattatgaaacttacattaggtctgagtcaggagac
gagcagcttccaaccatttgccgtgaagaccctgagatacacggctacttccgagacccc
cgctgcttcggggagcaggaatatttcagtagcgaggagtgctgtgaggatgacagttct
cccacctggagcaggcaaaactacagctattacaacaggtacccaggcagctccatggac
tttgagaggccccgaggctaccatcacccccaaggtttcttagaagatgacgactctccc
attggctatgactcacggagatctccaagaagacgccttctacctcctaccccaccatcc
catcggaggtcctccttcaactttgagtgtctgcgcaggcaaaacagccaagatgacgtc
cttccgtcgcctgccctgcctcaccgcgctgccctgcccctgcaccttatgcagcagcag
atcatggccgttgcaggcctagattccagtaaagcccagaagtactcgccgagccactct
acccggtcatgggccacccctccagcaacccctccgtaccgagactggaccccatgctac
acccctttgatccaggtggatcgctcagagtctatggaccaggtcaatggcagcctgccg
tcgctacaccgcagttcctggtatacagatgaacccgacatctcctataggactttcaca
ccggccagcctgaccgtccccagcagcttccggaacaaaaacagcgacaagcagaggagt
gcagacagcctggtggaagcagtcctgatatccgaaggcttgggacgctacgcaagggac
ccaaaatttgtctcagcaacaaaacatgagatcgccgatgcctgtgacctaaccatagac
gagatggagagcgcggccagcaccctgctcaatggaagcgtgtgtcctcgagccaacggg
gacatgggccccatctcacaccgccaggactatgagctccaggactttggtcctggctac
agtgacgaggaaccagaccctgggcgagaggaagaggacctggcagatgaaatgatttgc
atcaccaccttgtag

KEGG   Rattus norvegicus (rat): 682930
Entry
682930            CDS       T01003                                 

Gene name
Cacna1s
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1S
  KO
K04857  voltage-dependent calcium channel L type alpha-1S
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04723  Retrograde endocannabinoid signaling
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04921  Oxytocin signaling pathway
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04929  GnRH secretion
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno05010  Alzheimer disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    682930 (Cacna1s)
   04020 Calcium signaling pathway
    682930 (Cacna1s)
   04024 cAMP signaling pathway
    682930 (Cacna1s)
   04022 cGMP-PKG signaling pathway
    682930 (Cacna1s)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    682930 (Cacna1s)
   04929 GnRH secretion
    682930 (Cacna1s)
   04912 GnRH signaling pathway
    682930 (Cacna1s)
   04921 Oxytocin signaling pathway
    682930 (Cacna1s)
   04935 Growth hormone synthesis, secretion and action
    682930 (Cacna1s)
   04924 Renin secretion
    682930 (Cacna1s)
   04925 Aldosterone synthesis and secretion
    682930 (Cacna1s)
   04927 Cortisol synthesis and secretion
    682930 (Cacna1s)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    682930 (Cacna1s)
   04261 Adrenergic signaling in cardiomyocytes
    682930 (Cacna1s)
   04270 Vascular smooth muscle contraction
    682930 (Cacna1s)
  09156 Nervous system
   04727 GABAergic synapse
    682930 (Cacna1s)
   04725 Cholinergic synapse
    682930 (Cacna1s)
   04726 Serotonergic synapse
    682930 (Cacna1s)
   04723 Retrograde endocannabinoid signaling
    682930 (Cacna1s)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    682930 (Cacna1s)
   05020 Prion disease
    682930 (Cacna1s)
   05022 Pathways of neurodegeneration - multiple diseases
    682930 (Cacna1s)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    682930 (Cacna1s)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    682930 (Cacna1s)
   05414 Dilated cardiomyopathy
    682930 (Cacna1s)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    682930 (Cacna1s)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    682930 (Cacna1s)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   682930 (Cacna1s)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ PKD_channel CAC1F_C
Other DBs
NCBI-GeneID: 682930
NCBI-ProteinID: NP_446325
RGD: 70983
Ensembl: ENSRNOG00000046231
UniProt: Q02485
Position
13
AA seq 1850 aa
MEPSSPQDEGLRKKQPKKPVPEILPRPPRALFCLTLQNPLRKACISVVEWKPFETIILLT
IFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRS
GWNVLDFIIVFLGVFTAILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVP
SLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENE
KPSPCARTGSGRPCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYW
VNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLE
EDLRGYMSWITQGEVMDVDDLREGKLSLDEGGSDTESLYEIEGLNKIIQFIRHWRQWNRV
FRWKCHDLVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLALFTIEML
MKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMTPLGISVLRCIRLLRLFKITK
YWTSLSNLVASLLNSIRSIASLLLLLFLFMIIFALLGMQLFGGRYDFEDTEVRRSNFDNF
PQALISVFQVLTGEDWNSVMYNGIMAYGGPSYPGVLVCIYFIILFVCGNYILLNVFLAIA
VDNLAEAESLTSAQKAKAEERKRRKMSRGLPDKSEEERSTMTKKLEQKPKGEGIPTTAKL
KIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPASPRPRPLAELQLKEKAVPIPEASSFF
IFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFT
AVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISVVKILRVLR
VLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDL
SKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLL
YKAIDSNEEDTGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCE
LDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHY
NQSEQMNHISDILNVAFTIIFTLEMILKLIAFKPRGYFGDPWNVFDFLIVIGSIIDVILS
EIDTLLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLIKLLSRAEGVRTLLWTF
IKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVDGTQINRNNNFQTFPQAVLLLFRCA
TGEAWQEILLACSYGKRCDPESDYAPGEEYACGTNFAYYYFISFYMLCAFLIINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCP
HRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGNFEQANEELRAIIKKIWKR
TSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPKKDTVQIQAGLR
TIEEEAAPEIHRAISGDLTAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNSLPP
VMANQRPLQFAEMEMEELESPVFLEDFPQNPGTHPLARANTNNANANVAYGNSSHRNSPV
FSSIRYERELLEEAGRPVTREGPFSQPCSVSGVNSRSHVDKLERQMSQRRMPKGQVPPSP
CQLSQEKHPVHEEGKGPRSWSTETSDSESFEERVPRNSAHKCTAPATTMLIQEALVRGGL
DSLAADANFVMATGQALADACQMEPEEVEVAATELLKRESPKGGAMPREP
NT seq 5553 nt   +upstreamnt  +downstreamnt
atggagccgtcctcaccccaggatgagggcctgaggaagaagcagcctaagaaacccgtc
cctgagattctgccgaggccaccccgggccttgttctgcttgactctccagaaccccctg
aggaaggcctgcatcagcgtcgtggagtggaaacccttcgagaccatcatcttgctcacc
atcttcgccaactgtgtggccctggcagtgtacctgcccatgccagaggatgacaacaac
actctgaaccttggcctggagaaactggagtacttcttcctcatcgtcttctccattgag
gctgctatgaagatcatagcctatggcttcctattccatcaggatgcttacctgcgcagt
ggctggaacgtgctggacttcatcattgtctttctgggtgtcttcaccgcgattctggaa
caagttaacatcattcaaaccaacacggcccccatgagcagcaaaggagccggcttggat
gtgaaggccctgcgagctttccgcgtgctcagacccctgcggctggtgtcaggggtgccc
agccttcaggtagtcctcaactccatcttcaaggccatgctccccctgttccacatcgcc
ctgctcgtcctcttcatggtcatcatctatgccatcatcgggctggagctcttcaagggc
aagatgcacaagacgtgctacttcattgggacagacatcgtggccacagtagagaatgag
aaaccatcaccctgtgctagaactggctccgggcgcccctgcaccatcaacggcagcgag
tgccgaggaggttggccaggacccaaccatggcatcacccacttcgacaactttggcttc
tctatgctcactgtgtaccagtgcatctccatggaggggtggaccgatgtcctgtactgg
gtcaatgatgccatcgggaacgagtggccctggatctactttgtcaccctcattctgctg
ggctccttcttcatcctgaacctggtgctgggtgtcctgagtggagaattcaccaaggag
cgagagaaggccaagtccagaggaaccttccaaaagctccgggagaagcagcagctggag
gaagaccttcgtggttacatgagttggatcacacagggcgaggtcatggacgtggacgac
ttgagagaaggcaagctgtctttggatgaagggggctcggatacagagagcttatatgaa
atcgagggcttgaacaaaatcatccaattcattcggcactggcggcagtggaatcgcgtc
ttccgctggaagtgccatgacctagtgaaatccaaggtcttctattggctggtgatcctg
attgtggccctcaacaccctgtccattgcctcagagcaccacaaccagccactctggctg
acgcatttgcaagatgtcgccaaccgcgtgctgctggccctcttcaccatcgagatgctc
atgaagatgtacgggctgggcctgcgccagtacttcatgtccatcttcaaccgcttcgac
tgcttcgtggtgtgcagcggcatcctggagatcttgctggtggagtcgggagccatgacg
cccctgggcatctctgtgctccgctgcatccgcctcctgaggctcttcaagatcaccaag
tactggacatcgctgagcaacctggtggcctcgctgctcaactccatccgctctatcgct
tccctcttgctgctgctctttcttttcatgatcatctttgccctgctaggcatgcagctc
tttggaggcagatacgactttgaagacacggaagtacgacgaagcaactttgacaacttc
ccccaggccctcatcagtgtcttccaggtcctgacgggtgaagactggaactctgtgatg
tacaatgggatcatggcctacggaggcccgtcctaccctggcgtgctcgtgtgcatttat
ttcatcatcctttttgtctgtggtaactacatccttctcaatgtcttcctggctatcgct
gtggacaacctggcagaggctgagagcctgacatctgcccagaaggccaaggctgaggag
agaaagcgcaggaagatgtctagagggctcccagacaagtcagaagaggagagatccaca
atgaccaagaagctggagcagaaacccaagggtgaaggcatccccaccactgccaagctg
aaaatcgatgagtttgaatcgaacgtcaatgaggtgaaagacccctacccttcagctgac
ttcccaggggacgacgaggaagatgagcctgagatcccagcaagcccccgaccacgccct
ctggctgagctgcagctgaaagagaaagcggtgcccatcccagaggccagctccttcttc
atcttcagccccaccaataagatccgcgtcctatgtcaccgcattgtcaacgccacctgg
ttcaccaactttatcctactcttcatcctgctcagtagtgctgctctggccgctgaggac
cccatccgggccgactccatgaggaatcagatccttgagtattttgattatgtgttcact
gctgttttcactgtggagatcgtccttaagatgaccacctatggagccttcctgcacaaa
ggctccttctgccgcaactacttcaacatcctggacctgctggtagtggctgtgtctctc
atctccatgggcctcgagtccagcgccatctccgtggtgaagatcttgagggtcctgagg
gtgttgcgaccactccgggccataaacagagccaaagggttgaagcacgtggtgcagtgc
gtgtttgttgctatccgcaccatcgggaacatcgtgctggtcaccacgctcctgcagttc
atgtttgcatgcatcggagtccagcttttcaagggaaaattctacagctgcaatgattta
tccaagatgactgaagaggagtgcaggggctactactacatatacaaggatggagacccc
acgcagatagagttgcgaccccgtcagtggatacacaatgacttccactttgacaatgtc
ctgtctgctatgatgtcactcttcacggtctccacctttgagggttggcctcagctactg
tacaaggccatagactccaatgaggaggacacaggccccgtctacaacaaccgagtggag
atggccatcttcttcatcatctacatcattctcatcgccttcttcatgatgaacatcttt
gtgggcttcgtcatcgtcaccttccaggagcagggggagactgagtataagaactgtgag
ctggacaagaaccagcgccaatgtgtgcagtatgccctgaaggcccgcccgctgaggtgt
tacatccccaaaaacccataccagtatcaggtgtggtatgtcgtcacttcctcctacttt
gaatacctgatgtttgctctcatcatgctcaacactatctgcctaggcatgcagcattac
aaccagtcggaacagatgaaccacatatcggacatcctcaatgtggctttcaccatcatc
ttcaccctggagatgatcctcaagctcatagctttcaagcccaggggctattttggagac
ccctggaacgtgtttgactttctaatcgtcattggcagcatcattgacgttatcctgagt
gagatcgatactttgctggcctccagcgggggactatattgcctgggtggaggctgcggg
aacgttgacccagatgagagcgcccgcatctccagtgccttcttccgcctgttccgagtc
atgcgactgatcaagctgctgagccgggcggagggtgtgcgcaccctgctctggacgttc
atcaagtccttccaggccctgccgtatgtggctttgctgatcgtcatgctcttcttcatc
tacgctgtcatcggcatgcagatgttcgggaagatcgccatggtggacgggacgcaaata
aaccggaacaacaacttccagactttcccacaagctgtgctgctgctcttcaggtgtgcc
acaggggaagcctggcaggagatcctgctggcctgcagctacgggaaacgctgcgacccg
gagtctgactacgcaccgggggaggagtacgcgtgtggcaccaactttgcctactactac
ttcatcagcttctacatgctctgcgccttcctgatcatcaacctctttgtggctgtcatc
atggacaactttgactacctcacaagggactggtccattctgggccctcaccacctggat
gagttcaaggccatctgggctgagtacgacccagaggctaagggcaggatcaagcacctg
gacgtggtgaccctgctgaggaggatccagccccctctgggctttgggaagttctgccca
cacagggtagcatgtaagaggctggtgggcatgaacatgcccctgaatagtgatggcaca
gtcaccttcaatgccacactcttcgccctggtacgcacagccctcaagatcaagacagaa
ggcaattttgaacaagccaatgaggagctgagagccatcatcaaaaagatctggaagaga
accagcatgaagctcctggaccaagtcatccctccaataggagatgacgaggtgacagtg
gggaagttctatgccacattcctcatccaggagcactttcggaagttcatgaagcgccag
gaggaatattatgggtatcgacccaaaaaggacacagttcagatacaggctggattgcgg
accatagaggaagaggcagctcctgagatccaccgagccatctctggagacctgacggcg
gaggaggagctggagagggccatggtagaggctgccatggaggaggggatattccggaga
actggaggcctgtttggtcaagtggacaacttcctggaaaggaccaactctctgccccct
gtcatggctaaccaaagacccctccaatttgccgaaatggagatggaagagctggagtca
ccagtctttttggaggacttccctcagaacccaggcacccaccctcttgctcgtgccaat
accaacaacgccaatgccaatgttgcctatggcaacagcagccatagaaacagcccagtg
ttttccagcatccgctatgaaagggagctcctggaagaggcaggcaggcctgttaccaga
gaaggacccttcagtcagccctgcagcgtctctggagttaacagcagatcccatgtggac
aaactggaaagacagatgtcccaaagaagaatgcccaaaggccaggtgcctccttcccca
tgccagctctcccaggaaaagcatcctgtgcacgaagaggggaagggccccaggtcatgg
tctacggaaacatctgacagtgagagctttgaggagcgtgttcccaggaattcggctcac
aagtgcacagccccagctaccaccatgctgatccaggaggctctggttcgaggaggacta
gactccttagcagcagatgctaacttcgtcatggcaacaggccaggccctggcagatgcc
tgccagatggaaccagaggaagtcgaggtggcagcaacagagctactgaagcgagaatcc
ccaaagggcggggccatgcccagggagccttga

DBGET integrated database retrieval system