KEGG   Rattus norvegicus (rat): 114494
Entry
114494            CDS       T01003                                 

Gene name
Ccna2
Definition
(RefSeq) cyclin-A2
  KO
K06627  cyclin-A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04152  AMPK signaling pathway
rno04218  Cellular senescence
rno04914  Progesterone-mediated oocyte maturation
rno05161  Hepatitis B
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05203  Viral carcinogenesis
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    114494 (Ccna2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114494 (Ccna2)
   04218 Cellular senescence
    114494 (Ccna2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    114494 (Ccna2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114494 (Ccna2)
   05202 Transcriptional misregulation in cancer
    114494 (Ccna2)
   05203 Viral carcinogenesis
    114494 (Ccna2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    114494 (Ccna2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114494 (Ccna2)
   05161 Hepatitis B
    114494 (Ccna2)
   05169 Epstein-Barr virus infection
    114494 (Ccna2)
   05165 Human papillomavirus infection
    114494 (Ccna2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    114494 (Ccna2)
   03036 Chromosome and associated proteins [BR:rno03036]
    114494 (Ccna2)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    114494 (Ccna2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    114494 (Ccna2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Other DBs
NCBI-GeneID: 114494
NCBI-ProteinID: NP_446154
RGD: 621059
Ensembl: ENSRNOG00000015423
UniProt: G3V802 Q91ZX8
Position
2
AA seq 418 aa
MPGNSRQAGSALLSQQEDQENVNPEKVAPAQQPRAQAVLKAGKVRGPAPQQRLKTRRVAP
LKDLPINDEHVPTVPSWKAVSKQPAFTIHVDEAEETQKRPAEQKETQCEDALAFSAAVSL
PGARKPLVPLDYPMDGSFESPHAMDISIVLEDEKPVNVNEVPDYHEDIHTYLREMEVKCK
PKVSYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQ
LVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPTVNQF
LTQYFLHLQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQSWPE
SLVQKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPETLNV
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgccgggcaactcgagacaggcgggctcggccctgctctcccagcaggaagaccaggag
aatgtcaaccccgaaaaagtggcgccagcccagcagccgcgggcgcaggcggtgctgaag
gccgggaaggtgcggggaccggcgccgcagcagaggctcaagactcggcgggttgcgcct
cttaaggaccttcctataaacgatgagcacgtccctactgttccttcatggaaagcagtc
agtaaacagcctgccttcaccattcatgtggatgaagctgaagagactcagaagaggcca
gctgagcaaaaagaaactcagtgtgaagatgccctggcttttagtgccgctgtctcttta
cccggagccagaaaaccactggtacctcttgattatccaatggatggtagttttgaatca
ccccatgctatggatatatctattgtcttagaagacgaaaagccagtgaatgttaatgaa
gtacctgactatcatgaagatattcacacgtaccttagggaaatggaggttaaatgtaaa
cctaaagtgagttatatgaagaggcagccagacatcactaacagtatgcgggccatcctt
gtggactggctagttgaagtgggagaagaatataaactacagaatgagaccctgcatttg
gctgtgaactacattgatagattcctctcctccatgtctgtgttaagaggaaagcttcag
cttgtgggcacagctgctatgctgctagcttcaaagtttgaagaaatataccccccagaa
gtagcagagtttgtgtatattacggacgatacctattccaagaagcaggttctgagaatg
gagcaccttgtattgaaagtccttgcttttgacttggctgcaccaacagtaaatcagttc
cttacccagtacttcctgcacctgcagcctgccaactgcaaggtagaaagcttagcgatg
tttttgggagagttaagtttgatagatgctgacccatacctcaagtatttgccatcgctt
attgctggagctgccttccacttagctctctacacagtcacaggacaaagctggcctgag
tcattggtacaaaagactggatataccctagaaagtcttaagccttgtctcatggacctt
caccagacctacctcaaagcaccacagcatgcccaacagtcaataagggaaaagtacaag
cattcaaaatatcacagtgtttctcttctcaacccaccagagacactaaatgtgtga

KEGG   Rattus norvegicus (rat): 295052
Entry
295052            CDS       T01003                                 

Gene name
Ccna1
Definition
(RefSeq) cyclin-A1
  KO
K06627  cyclin-A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04152  AMPK signaling pathway
rno04218  Cellular senescence
rno04914  Progesterone-mediated oocyte maturation
rno05161  Hepatitis B
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05203  Viral carcinogenesis
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    295052 (Ccna1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    295052 (Ccna1)
   04218 Cellular senescence
    295052 (Ccna1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    295052 (Ccna1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    295052 (Ccna1)
   05202 Transcriptional misregulation in cancer
    295052 (Ccna1)
   05203 Viral carcinogenesis
    295052 (Ccna1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    295052 (Ccna1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    295052 (Ccna1)
   05161 Hepatitis B
    295052 (Ccna1)
   05169 Epstein-Barr virus infection
    295052 (Ccna1)
   05165 Human papillomavirus infection
    295052 (Ccna1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    295052 (Ccna1)
   03036 Chromosome and associated proteins [BR:rno03036]
    295052 (Ccna1)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    295052 (Ccna1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    295052 (Ccna1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2 Peroxidase_2
Other DBs
NCBI-GeneID: 295052
NCBI-ProteinID: NP_001011949
RGD: 1310639
Ensembl: ENSRNOG00000014052
UniProt: Q6AY13
Position
2
AA seq 421 aa
MRRHSSKSGVALPPVGQGPDACQMLTRAQLGQDPPQRTVLGVLTENEQYRRACGQEIATI
RCFSGSENVFPAAGKKVLPDNGVSEPAKHGFDIYMDDPEQGDRDSCPGREGIVFEDVYEV
DTSMLKSDLHFLLDFNTVSPMLVDSTAHAQSEEATDFGSDVINVTEYAEEIHRYLREAEV
RHRPKAHYMRKQPDITEGMRAILVDWLVEVGEEYKLRTETLYLAVNFLDRFLSCMSVLRG
KLQLVGTAAILLASKYEEIYPPDVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTT
NQFLLQYLRRQGVCIRTENLAKYVAELSLLEADPFLKYLPSLVAAAAYCLANYIVNRHFW
PETLAAFTGYSLNEIVPCLSELHKACLSIPHRPQQAIREKYKASKYLHVSLMEPPVVLPL
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcgtcgccacagctcgaagagtggagtcgcactgcctccagtgggccaaggtcctgat
gcttgtcagatgctcacccgagctcagcttggccaggatcccccacagagaaccgtgcta
ggagtgttgactgaaaatgagcagtacaggagggcctgtggccaggagatcgcaacgatc
agatgtttttctggatcagaaaatgtcttccctgcagctggaaagaaagtactccctgac
aacggggtcagtgagccagccaagcatggatttgatatctacatggatgatcctgaacag
ggggacagagacagctgcccagggagagagggcatagtgtttgaggatgtgtatgaagta
gacaccagcatgctcaagtcagatctccacttcctgctggatttcaacacagtttcccca
atgctggttgactccaccgcccatgcccagtcggaggaagcaacggattttggttcagat
gtgatcaacgtaacggaatatgcagaggagattcatcgataccttcgagaagctgaagta
agacacagacccaaggctcactacatgaggaagcagccggacatcacggagggcatgcgc
gccatcctggtggactggctggtggaggttggggaagaatataaactccgcacagagacc
ctgtacttggctgtcaacttcctggacaggtttctttcctgcatgtctgttctgagaggg
aaattgcagcttgtcgggacagcagctattctcctggcttcgaaatacgaagagatatac
ccgcccgatgtcgatgagtttgtctacatcactgacgacacgtacacaaagcgacagcta
ctgaggatggagcatctgctgctgaaagtcctggcattcgatctgaccgttccaaccacc
aaccagttcctccttcagtacttaaggcggcaaggggtgtgcatcaggactgagaatttg
gccaagtatgttgcagaactgagccttctggaagctgacccattcttgaagtatcttcct
tccttggtagcagcagcagcttactgtctggcaaactatattgtgaacagacacttctgg
ccagaaacacttgctgcatttacgggctattcattaaatgagattgtgccttgcctgagt
gagctgcataaagcatgcctcagtataccccatcgaccgcagcaagcaatcagggagaag
tacaaggcttcgaagtacctgcacgtgtccctcatggagccacccgtagttcttcccctg
cagtga

DBGET integrated database retrieval system