KEGG   Rattus norvegicus (rat): 114505Help
Entry
114505            CDS       T01003                                 

Gene name
Klf4, GKLF
Definition
(RefSeq) Kruppel like factor 4
  KO
K17846  krueppel-like factor 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    114505 (Klf4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    114505 (Klf4)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    114505 (Klf4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 DUF3850
Motif
Other DBs
NCBI-GeneID: 114505
NCBI-ProteinID: NP_446165
RGD: 621445
Ensembl: ENSRNOG00000016299
UniProt: Q923V7
Position
5q24
AA seq 482 aa AA seqDB search
MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRPAGAPTNRWREELSHMKRLPPLPGR
PYDLAATVATDLESGGAGAACSSNNPALPRRETEEFNDLLDLDFILSNSLSHQESVAATV
TTSASASSSSSPASSGPASAPSTCSFSYPIRAGGDPGVAAGNTGGGLLYSRESAPPPTAP
FNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSTPGSEYTS
PSVISVSKGSPDGSHPVVVAPYSGGPPRMCPKIKQEAVPSCTVSRSLEAHLSAGPQLSNG
HRPNTHDFPLGRQLPTRTTPTLSPEELLNSRDCHPGLPLPPGFHPHPGPSYPPFLPDQMQ
SQVPSLHYQELMPPGSCLPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHL
RTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKR
HF
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagccacctggcgagtctgacatggctgtcagcgacgctctgctcccgtccttc
tccacgttcgcgtccggcccggcgggaagggagaagacactgcgtccagcaggtgccccg
actaaccgttggcgagaggaactctctcacatgaagcgacttcccccacttcccggccgc
ccctacgacctggcggcgacggtggccacagacctggaaagtggtggagctggtgcagct
tgcagcagtaacaacccggccctaccccggagggagaccgaggagttcaacgatctcctg
gacctagactttatcctttccaactcgctatcccaccaggaatcggtggccgccaccgtg
accacctcggcgtcagcttcatcctcgtcttccccagctagcagcggccctgccagcgcg
ccctccacctgcagcttcagctatccgatccgggccgggggtgacccgggcgtggctgcg
ggcaacacaggtggagggctcctctacagccgagaatctgcgccacctcccacggccccc
ttcaacctggcggacatcaatgacgtgagcccctcgggcggcttcgtggctgagctcctg
cggccggagttggacccagtatacattccgccacagcagcctcagccgccaggtggcggg
ctgatgggcaagtttgtgctgaaggcgtctctgagcacccctggcagcgagtacaccagc
ccttcggtcatcagtgttagcaaaggaagcccagacggcagccaccctgtggtagtggcg
ccctacagcggtggcccgccgcgtatgtgccccaagattaagcaagaggccgtcccgtcc
tgcacggtcagccggtccctagaggcccacttgagcgctggaccccagctcagcaacggc
cacaggcccaacacacacgacttccccctggggcggcagctccccaccaggactacccct
acactgagtcccgaggaactgctgaacagcagggactgtcaccctggcctgcctcttccc
ccaggattccatccccatccggggcccagctaccctcctttcctgccagaccagatgcag
tcgcaagtcccctctctccattatcaagagctcatgccaccgggatcctgcctgccagag
gagcccaagccaaagaggggaagaaggtcttggccccggaaaagaacagccacccacact
tgtgactatgcaggctgtggcaaaacctatacgaagagttctcatctcaaggcacacctg
cgaactcacacaggcgagaaaccttaccactgtgactgggacggctgtgggtggaaattc
gcccgctcagatgaactgaccaggcactaccgcaaacacaccgggcaccggccctttcag
tgccagaagtgcgacagggccttttccaggtcggaccaccttgccttacacatgaagagg
cacttttaa

DBGET integrated database retrieval system