KEGG   Rattus norvegicus (rat): 114507Help
Entry
114507            CDS       T01003                                 

Gene name
Slc5a3, Smit
Definition
(RefSeq) solute carrier family 5 member 3
  KO
K14383  solute carrier family 5 (sodium/myo-inositol cotransporter), member 3
Organism
rno  Rattus norvegicus (rat)
Brite
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC5: Sodium glucose cotransporter
   114507 (Slc5a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-GeneID: 114507
NCBI-ProteinID: NP_446167
RGD: 621530
UniProt: Q80WA5
Position
11q11
AA seq 718 aa AA seqDB search
MRAVLETADIAIVALYFVLVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVAIGASLFVSNI
GSEHFIGLAGSGAASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMPEYLSKRFGGH
RIQVYFAALSLLLYIFTKLSVDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVA
VIYTDTLQALLMIIGALTLMVISMMKVGGFEEVKRRYMLASPNVASILLTHNLSNTNSCM
VHPKADALKMLRDPTDEDVPWPGFILGQTPASVWYWCADQVIVQRVLAAKNIAHAKGSTL
MAGFLKLLPMFIIVVPGMISRILFVDDIACINPEHCMQVCGSRAGCSNIAYPRLVMELVP
VGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLLRNNASSRELMIVGRIFVAFMVV
ISIAWVPIIVEMQGGQMYLYIQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFVL
GAIRLILAFTYRAPECDQPDNRPSFIKDIHYMYVATALFWITGLITVIVSLLTPPPTKDQ
IRTTTFWSKKTVVTKESCSQKDEPYKMQEKSILRCSENSEVVSHTIPNGKSEDSIKGLQP
EDVNLLVTCREEGNPVASMGHSEAETPVDAYSNGQAALMGERAREKETESRSRYWKFIDW
FCGFKSRSLSKRSLRDSMDEEAVCLQMLEETPRVRVILNIGLFAVCSLGIFMFVYFSL
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgagggctgtgctggagacagcagacattgccatagtggccctgtattttgtcctggtc
atgtgcattggtttctttgccatgtggaaatctaatagaagcactgtgagtggatacttc
ctggccgggcgctctatgacctgggtggccattggtgcctctctgtttgtgagcaatatt
gggagtgaacacttcattgggctggcaggatctggagcagccagtggatttgcagtgggc
gcatgggagttcaatgccttgctgctcttgcaacttctgggatgggttttcatccctatt
tacatccgctcaggggtgtacaccatgcctgaatatttgtccaagaggttcggtggccat
aggattcaggtctattttgcggccttgtccctgctcctctatatcttcaccaagctctcg
gtggatctgtactcaggggccctctttatccaggagtccttgggttggaacctttatgtg
tctgtcatcctgctcattggcatgactgctctgctgaccgtcactggaggccttgttgca
gtgatctacacagacactctccaggctctgctcatgatcattggggcactgacacttatg
gttattagcatgatgaaggttggagggtttgaggaagttaagagaaggtacatgttggcc
tcacccaatgttgcttccattttgttgacacacaacctttccaacacaaattcttgtatg
gtgcatcctaaggcagatgccctaaagatgttgagagatccaacagatgaagacgtccca
tggcctggattcattcttgggcagaccccagcctcggtatggtactggtgtgctgaccaa
gtcatcgtgcagagggttctagcagccaaaaacattgctcatgccaaaggttctactctg
atggctggcttcttgaagctcctaccaatgtttatcatagtcgtacccggaatgatttcc
aggatactgtttgttgatgatatagcttgcatcaacccagaacactgcatgcaagtgtgt
ggaagcagagctgggtgctccaatattgcttacccacgcctggtgatggagttggttccc
gtgggccttcggggcctgatgatggcagtgatgattgcagctctgatgagcgacttggac
tccatctttaacagcgccagtaccatattcaccctcgatgtgtacaagcttctccgcaac
aatgcaagctcgcgggaactgatgattgtgggcaggatatttgtggcttttatggttgtc
atcagcatagcatgggtgccaattattgtggagatgcaaggaggccaaatgtacctttat
atccaggaggtggcggattatctgacccctccggtggcggccctcttccttctggcaatt
ttctggaaacgttgcaatgagcaaggggctttctatggtggaatggcaggttttgttctt
ggagctatccgtttgatactggctttcacctaccgtgctcctgagtgtgaccaacctgat
aacaggcccagcttcatcaaagacatccattatatgtatgtggctacagcattattttgg
atcacaggactcattactgtaattgttagtcttctcacaccacctcccacgaaggatcag
attcgtaccactaccttttggtcaaaaaagactgtggtgacgaaggagagttgctctcag
aaagacgaaccatataaaatgcaagagaagagtattctgcgatgcagtgagaatagtgaa
gtcgtcagccacactattcccaatgggaagtctgaagacagcattaaggggctccaacct
gaagacgttaatctgctggtgacatgccgagaggagggcaacccagtggcttccatgggt
cattcagaagcagaaacaccagtagatgcttattccaatgggcaagcagctctcatgggt
gagagagcgcgagagaaggaaacagaaagtagaagccggtattggaagttcatagactgg
ttttgtggctttaaaagtagaagcctgagcaagaggagcctcagagactcgatggacgag
gaggccgtttgtttgcagatgttagaggagaccccacgagtcagagtgatcctaaacatt
ggactttttgctgtgtgttcactcgggattttcatgtttgtttatttctccttatga

DBGET integrated database retrieval system