KEGG   Rattus norvegicus (rat): 114509
Entry
114509            CDS       T01003                                 

Gene name
Mapk7, Bmk1, Erk5, Prkm7
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04540  Gap junction
rno04657  IL-17 signaling pathway
rno04722  Neurotrophin signaling pathway
rno04912  GnRH signaling pathway
rno04921  Oxytocin signaling pathway
rno05206  MicroRNAs in cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114509 (Mapk7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    114509 (Mapk7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    114509 (Mapk7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    114509 (Mapk7)
   04921 Oxytocin signaling pathway
    114509 (Mapk7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    114509 (Mapk7)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    114509 (Mapk7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    114509 (Mapk7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    114509 (Mapk7)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     114509 (Mapk7)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   114509 (Mapk7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH
Other DBs
NCBI-GeneID: 114509
NCBI-ProteinID: NP_001178476
RGD: 621505
Ensembl: ENSRNOG00000002412
UniProt: E9PTH2
Position
10q22
AA seq 812 aa
MAEPLKEEDGEDGSGEPPGRVKAEPVHSAASVVAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFRSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPVCPDVEMP
SPWAPSGDCAMESPPPALPPCSGPAPDTVDLTLQPAPPASELAPPKREGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGTLGGPSTDPLAGLVLSDNDRSLLERWTRMARPPVPAPAPAPAPTPKPTPTPTQS
SAQPTSPPNGPVSQSTAPLQPAGSIPGPASQPVCPPPGPVPQPAGPVPAPLQTAPSTSLL
ASQSLVPPSGLPGSGAPEVLPYFPSGPPPPDPGLTPQPSTSESPDVNLVTQQLSKSQVED
PLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDSQADSASLSASLLADWLEG
HGMNPADIESLQREIQMDSPMLLSDLPDLQEP
NT seq 2439 nt   +upstreamnt  +downstreamnt
atggccgaaccgttgaaggaggaggacggcgaagatggctctggggaaccccctgggcgg
gtgaaggcagaacccgtccactccgctgcatctgtcgtggccaagaacctggccctgctc
aaagcccgctccttcgacgtgacctttgacgtgggggacgagtacgagatcatcgagacc
ataggcaatggggcctacggggtggtgtcctcggcgcgccgccgcctcacgggtcagcag
gtggccatcaagaagatacctaatgcttttgatgtggtgaccaatgccaaacggaccctc
agggaactgaagatcctcaaacacttcaaacacgacaatatcatcgccatcaaggacatc
ctgaggcccactgtgccctatggagaattcagatctgtctacgtggtactggacctcatg
gaaagtgacctacaccagatcattcactcttcacagccgctcacactagaacatgtgaga
tacttcctataccagctgcttcggggcctcaaatacatgcactctgctcaggtcatccac
cgcgatcttaaaccctctaaccttttggtcaatgagaactgtgagctcaagattggtgac
tttggaatggcccgtggcctgtgtacatcccctgccgagcaccagtacttcatgactgag
tatgtggccactcgctggtaccgtgctcctgaactcatgctttcgctgcatgagtacaca
caggctattgacctctggtctgtgggctgcatctttggtgagatgctggctcggcgacag
ctcttcccaggcaaaaactatgtgcatcagttacagctgatcatgatggtgttgggaact
ccatcaccagctgtgattcaggctgtgggggctgaaagggtgcgagcctatatccagagc
ctgccaccaaggcagcctgtaccttgggagacagtatacccgggtgctgaccgccaggcc
ctctcactgctgggacgcatgttgcgatttgaacccagtgcccgaatctcagctgctgct
gcccttcgccaccccttcctggctaagtaccacgaccctgacgatgagcctgattgcgcc
ccaccttttgactttgcttttgaccgtgaagcccttaccagggagcgcattaaggaggcc
attgtggctgagattgaggacttccatgcacgacgggagggcatccgccaacaaattcgc
ttccagccctctttgcagcctgtggctagtgagcctgtgtgtccagatgtcgagatgccc
agcccctgggctccaagtggagactgtgccatggagtcacctcctccagcactaccacca
tgctctggccctgcccctgacactgttgatctgactctgcagcctgccccgcccgccagt
gagcttgctccgccaaaaagagagggtgccatctccgacaataccaaagcagccctcaaa
gctgctctgctcaagtccctgaggagccggcttcgagatgggcccagtgcacccttggag
gcccctgaacctcgaaagcctgtgacagctcaggaacgtcagcgagagcgagaagagaag
cgcaggaggcgacaagagagagccaaggagagggagaagcgacgacaagagcgggagcgc
aaggagaggggggctggcaccttggggggcccctctactgaccctttggctggattggtg
ctcagtgacaatgaccgaagcctgctagagcggtggactcgcatggctaggcctcctgtc
cctgcaccagcaccagcaccagcaccaacaccaaaaccaacaccaacaccaacacagtcc
tctgctcaacccactagtcctcccaatggccctgtatctcagtctactgctcctctacag
cctgcaggctctattcctggtcctgcctcccagcctgtttgcccaccccctgggcctgtt
ccccagcctgctggccctgtccctgcccctctccagactgccccttccactagccttttg
gcctcccagtcacttgtgccacctagtgggttgcctggttctggtgccccagaagttctg
ccttacttcccatctggcccaccacctccagatcctgggctcacccctcagccttctaca
tcagagtcacctgatgtcaacctggtgacccagcaactgtccaagtctcaggtggaggac
cccctgcctcccgtgttctcaggcactccaaagggcagtggggctggctacggtgttggc
tttgacctggaggaattcttaaaccaatcttttgacatgggtgtggctgatgggccacag
gatagccaggcagactcagcctcactctcagcctccctccttgctgactggcttgagggc
cacggcatgaaccccgctgacattgagtctctgcagcgtgagatccagatggactcccca
atgttgctgtctgacctgcctgacctccaagaaccctga

DBGET integrated database retrieval system