KEGG   Rattus norvegicus (rat): 114509
Entry
114509            CDS       T01003                                 

Gene name
Mapk7
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04540  Gap junction
rno04657  IL-17 signaling pathway
rno04722  Neurotrophin signaling pathway
rno04912  GnRH signaling pathway
rno04921  Oxytocin signaling pathway
rno05206  MicroRNAs in cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114509 (Mapk7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    114509 (Mapk7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    114509 (Mapk7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    114509 (Mapk7)
   04921 Oxytocin signaling pathway
    114509 (Mapk7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    114509 (Mapk7)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    114509 (Mapk7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    114509 (Mapk7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    114509 (Mapk7)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     114509 (Mapk7)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   114509 (Mapk7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 Kinase-like APH
Other DBs
NCBI-GeneID: 114509
NCBI-ProteinID: NP_001178476
RGD: 621505
Ensembl: ENSRNOG00000002412
UniProt: E9PTH2
Position
10
AA seq 812 aa
MAEPLKEEDGEDGSGEPPGRVKAEPVHSAASVVAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFRSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPVCPDVEMP
SPWAPSGDCAMESPPPALPPCSGPAPDTVDLTLQPAPPASELAPPKREGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGTLGGPSTDPLAGLVLSDNDRSLLERWTRMARPPVPAPAPAPAPTPKPTPTPTQS
SAQPTSPPNGPVSQSTAPLQPAGSIPGPASQPVCPPPGPVPQPAGPVPAPLQTAPSTSLL
ASQSLVPPSGLPGSGAPEVLPYFPSGPPPPDPGLTPQPSTSESPDVNLVTQQLSKSQVED
PLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDSQADSASLSASLLADWLEG
HGMNPADIESLQREIQMDSPMLLSDLPDLQEP
NT seq 2439 nt   +upstreamnt  +downstreamnt
atggccgaaccgttgaaggaggaggacggcgaagatggctctggggaaccccctgggcgg
gtgaaggcagaacccgtccactccgctgcatctgtcgtggccaagaacctggccctgctc
aaagcccgctccttcgacgtgacctttgacgtgggggacgagtacgagatcatcgagacc
ataggcaatggggcctacggggtggtgtcctcggcgcgccgccgcctcacgggtcagcag
gtggccatcaagaagatacctaatgcttttgatgtggtgaccaatgccaaacggaccctc
agggaactgaagatcctcaaacacttcaaacacgacaatatcatcgccatcaaggacatc
ctgaggcccactgtgccctatggagaattcagatctgtctacgtggtactggacctcatg
gaaagtgacctacaccagatcattcactcttcacagccgctcacactagaacatgtgaga
tacttcctataccagctgcttcggggcctcaaatacatgcactctgctcaggtcatccac
cgcgatcttaaaccctctaaccttttggtcaatgagaactgtgagctcaagattggtgac
tttggaatggcccgtggcctgtgtacatcccctgccgagcaccagtacttcatgactgag
tatgtggccactcgctggtaccgtgctcctgaactcatgctttcgctgcatgagtacaca
caggctattgacctctggtctgtgggctgcatctttggtgagatgctggctcggcgacag
ctcttcccaggcaaaaactatgtgcatcagttacagctgatcatgatggtgttgggaact
ccatcaccagctgtgattcaggctgtgggggctgaaagggtgcgagcctatatccagagc
ctgccaccaaggcagcctgtaccttgggagacagtatacccgggtgctgaccgccaggcc
ctctcactgctgggacgcatgttgcgatttgaacccagtgcccgaatctcagctgctgct
gcccttcgccaccccttcctggctaagtaccacgaccctgacgatgagcctgattgcgcc
ccaccttttgactttgcttttgaccgtgaagcccttaccagggagcgcattaaggaggcc
attgtggctgagattgaggacttccatgcacgacgggagggcatccgccaacaaattcgc
ttccagccctctttgcagcctgtggctagtgagcctgtgtgtccagatgtcgagatgccc
agcccctgggctccaagtggagactgtgccatggagtcacctcctccagcactaccacca
tgctctggccctgcccctgacactgttgatctgactctgcagcctgccccgcccgccagt
gagcttgctccgccaaaaagagagggtgccatctccgacaataccaaagcagccctcaaa
gctgctctgctcaagtccctgaggagccggcttcgagatgggcccagtgcacccttggag
gcccctgaacctcgaaagcctgtgacagctcaggaacgtcagcgagagcgagaagagaag
cgcaggaggcgacaagagagagccaaggagagggagaagcgacgacaagagcgggagcgc
aaggagaggggggctggcaccttggggggcccctctactgaccctttggctggattggtg
ctcagtgacaatgaccgaagcctgctagagcggtggactcgcatggctaggcctcctgtc
cctgcaccagcaccagcaccagcaccaacaccaaaaccaacaccaacaccaacacagtcc
tctgctcaacccactagtcctcccaatggccctgtatctcagtctactgctcctctacag
cctgcaggctctattcctggtcctgcctcccagcctgtttgcccaccccctgggcctgtt
ccccagcctgctggccctgtccctgcccctctccagactgccccttccactagccttttg
gcctcccagtcacttgtgccacctagtgggttgcctggttctggtgccccagaagttctg
ccttacttcccatctggcccaccacctccagatcctgggctcacccctcagccttctaca
tcagagtcacctgatgtcaacctggtgacccagcaactgtccaagtctcaggtggaggac
cccctgcctcccgtgttctcaggcactccaaagggcagtggggctggctacggtgttggc
tttgacctggaggaattcttaaaccaatcttttgacatgggtgtggctgatgggccacag
gatagccaggcagactcagcctcactctcagcctccctccttgctgactggcttgagggc
cacggcatgaaccccgctgacattgagtctctgcagcgtgagatccagatggactcccca
atgttgctgtctgacctgcctgacctccaagaaccctga

KEGG   Rattus norvegicus (rat): 116554
Entry
116554            CDS       T01003                                 

Gene name
Mapk8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04024  cAMP signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04141  Protein processing in endoplasmic reticulum
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04310  Wnt signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04530  Tight junction
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04910  Insulin signaling pathway
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04926  Relaxin signaling pathway
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05231  Choline metabolism in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    116554 (Mapk8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    116554 (Mapk8)
   04012 ErbB signaling pathway
    116554 (Mapk8)
   04014 Ras signaling pathway
    116554 (Mapk8)
   04310 Wnt signaling pathway
    116554 (Mapk8)
   04668 TNF signaling pathway
    116554 (Mapk8)
   04068 FoxO signaling pathway
    116554 (Mapk8)
   04071 Sphingolipid signaling pathway
    116554 (Mapk8)
   04024 cAMP signaling pathway
    116554 (Mapk8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    116554 (Mapk8)
   04137 Mitophagy - animal
    116554 (Mapk8)
  09143 Cell growth and death
   04210 Apoptosis
    116554 (Mapk8)
   04215 Apoptosis - multiple species
    116554 (Mapk8)
   04217 Necroptosis
    116554 (Mapk8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    116554 (Mapk8)
   04530 Tight junction
    116554 (Mapk8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    116554 (Mapk8)
   04621 NOD-like receptor signaling pathway
    116554 (Mapk8)
   04622 RIG-I-like receptor signaling pathway
    116554 (Mapk8)
   04625 C-type lectin receptor signaling pathway
    116554 (Mapk8)
   04660 T cell receptor signaling pathway
    116554 (Mapk8)
   04658 Th1 and Th2 cell differentiation
    116554 (Mapk8)
   04659 Th17 cell differentiation
    116554 (Mapk8)
   04657 IL-17 signaling pathway
    116554 (Mapk8)
   04664 Fc epsilon RI signaling pathway
    116554 (Mapk8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    116554 (Mapk8)
   04920 Adipocytokine signaling pathway
    116554 (Mapk8)
   04912 GnRH signaling pathway
    116554 (Mapk8)
   04914 Progesterone-mediated oocyte maturation
    116554 (Mapk8)
   04917 Prolactin signaling pathway
    116554 (Mapk8)
   04926 Relaxin signaling pathway
    116554 (Mapk8)
   04935 Growth hormone synthesis, secretion and action
    116554 (Mapk8)
  09156 Nervous system
   04728 Dopaminergic synapse
    116554 (Mapk8)
   04723 Retrograde endocannabinoid signaling
    116554 (Mapk8)
   04722 Neurotrophin signaling pathway
    116554 (Mapk8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    116554 (Mapk8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    116554 (Mapk8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116554 (Mapk8)
   05231 Choline metabolism in cancer
    116554 (Mapk8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    116554 (Mapk8)
   05212 Pancreatic cancer
    116554 (Mapk8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    116554 (Mapk8)
   05170 Human immunodeficiency virus 1 infection
    116554 (Mapk8)
   05161 Hepatitis B
    116554 (Mapk8)
   05171 Coronavirus disease - COVID-19
    116554 (Mapk8)
   05162 Measles
    116554 (Mapk8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    116554 (Mapk8)
   05169 Epstein-Barr virus infection
    116554 (Mapk8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    116554 (Mapk8)
   05135 Yersinia infection
    116554 (Mapk8)
   05133 Pertussis
    116554 (Mapk8)
   05152 Tuberculosis
    116554 (Mapk8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    116554 (Mapk8)
   05142 Chagas disease
    116554 (Mapk8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    116554 (Mapk8)
   05012 Parkinson disease
    116554 (Mapk8)
   05016 Huntington disease
    116554 (Mapk8)
   05017 Spinocerebellar ataxia
    116554 (Mapk8)
   05020 Prion disease
    116554 (Mapk8)
   05022 Pathways of neurodegeneration - multiple diseases
    116554 (Mapk8)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    116554 (Mapk8)
   05418 Fluid shear stress and atherosclerosis
    116554 (Mapk8)
   05415 Diabetic cardiomyopathy
    116554 (Mapk8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    116554 (Mapk8)
   04932 Non-alcoholic fatty liver disease
    116554 (Mapk8)
   04931 Insulin resistance
    116554 (Mapk8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    116554 (Mapk8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    116554 (Mapk8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    116554 (Mapk8)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     116554 (Mapk8)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   116554 (Mapk8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 Kinase-like RIO1 APH FTA2 DUF530 TCAD9
Other DBs
NCBI-GeneID: 116554
NCBI-ProteinID: NP_446281
RGD: 621506
Ensembl: ENSRNOG00000020155
UniProt: P49185
Position
16
AA seq 427 aa
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCLKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPVSSPSVNDMSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagtaaacgtgacaacaatttttatagtgtagagatcggagattctacattc
acagtcctaaaacgataccagaacttaaagcctataggctcaggagctcaaggaatagtg
tgtgcagcttatgatgctattcttgaaagaaatgttgcaatcaagaagctcagccggcca
tttcagaatcagacccatgctaagcgagcctaccgagaactagttcttatgaagtgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggagttagatcatgaaagaatgtcctaccttctctatcaaatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcctagtaatatagtagtcaaa
tcagactgcactttgaagattcttgattttggactggcaaggactgcaggaacgagtttt
atgatgacgccttacgtggtaactcgttactacagagcaccagaggtcattctcggcatg
ggctacaaggagaacgtggatttatggtctgtggggtgcattatgggagaaatggtttgc
ctcaaaatcctctttccaggaagggactatattgatcagtggaataaagttattgaacag
ctcggaacaccttgtcctgaattcatgaagaaactacaaccaacagtaaggacttacgtt
gaaaacagacctaagtacgctggctatagctttgagaaactgtttcctgatgtgcttttc
ccagctgactcagaacataacaaacttaaagccagtcaggcgagagatttgttatctaaa
atgctggtgatagatgcgtccaaaaggatctccgtagacgaagctctccagcacccgtac
atcaacgtctggtatgatccttcagaagcagaggccccaccaccaaagatccctgacaag
cagttagatgaaagggagcacacaatagaggagtggaaagaactgatatacaaggaggtc
atggatttggaggagcgaactaagaatggcgtcataagagggcagccgtctcctttaggt
gcagcagtgatcaatggctctcagcatccggtctcttcgccgtctgtcaatgacatgtct
tcaatgtccacagatccgactctggcctcggatacagacagcagtctagaagcatcagct
ggacctctgggctgctgtagatga

KEGG   Rattus norvegicus (rat): 116590
Entry
116590            CDS       T01003                                 

Gene name
Mapk1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno01524  Platinum drug resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04114  Oocyte meiosis
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04350  TGF-beta signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04371  Apelin signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04520  Adherens junction
rno04540  Gap junction
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04668  TNF signaling pathway
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04730  Long-term depression
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04926  Relaxin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04929  GnRH secretion
rno04930  Type II diabetes mellitus
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04960  Aldosterone-regulated sodium reabsorption
rno05010  Alzheimer disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05034  Alcoholism
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05216  Thyroid cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    116590 (Mapk1)
   04012 ErbB signaling pathway
    116590 (Mapk1)
   04014 Ras signaling pathway
    116590 (Mapk1)
   04015 Rap1 signaling pathway
    116590 (Mapk1)
   04350 TGF-beta signaling pathway
    116590 (Mapk1)
   04370 VEGF signaling pathway
    116590 (Mapk1)
   04371 Apelin signaling pathway
    116590 (Mapk1)
   04668 TNF signaling pathway
    116590 (Mapk1)
   04066 HIF-1 signaling pathway
    116590 (Mapk1)
   04068 FoxO signaling pathway
    116590 (Mapk1)
   04072 Phospholipase D signaling pathway
    116590 (Mapk1)
   04071 Sphingolipid signaling pathway
    116590 (Mapk1)
   04024 cAMP signaling pathway
    116590 (Mapk1)
   04022 cGMP-PKG signaling pathway
    116590 (Mapk1)
   04151 PI3K-Akt signaling pathway
    116590 (Mapk1)
   04150 mTOR signaling pathway
    116590 (Mapk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    116590 (Mapk1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    116590 (Mapk1)
   04210 Apoptosis
    116590 (Mapk1)
   04218 Cellular senescence
    116590 (Mapk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    116590 (Mapk1)
   04520 Adherens junction
    116590 (Mapk1)
   04540 Gap junction
    116590 (Mapk1)
   04550 Signaling pathways regulating pluripotency of stem cells
    116590 (Mapk1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    116590 (Mapk1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    116590 (Mapk1)
   04613 Neutrophil extracellular trap formation
    116590 (Mapk1)
   04620 Toll-like receptor signaling pathway
    116590 (Mapk1)
   04621 NOD-like receptor signaling pathway
    116590 (Mapk1)
   04625 C-type lectin receptor signaling pathway
    116590 (Mapk1)
   04650 Natural killer cell mediated cytotoxicity
    116590 (Mapk1)
   04660 T cell receptor signaling pathway
    116590 (Mapk1)
   04658 Th1 and Th2 cell differentiation
    116590 (Mapk1)
   04659 Th17 cell differentiation
    116590 (Mapk1)
   04657 IL-17 signaling pathway
    116590 (Mapk1)
   04662 B cell receptor signaling pathway
    116590 (Mapk1)
   04664 Fc epsilon RI signaling pathway
    116590 (Mapk1)
   04666 Fc gamma R-mediated phagocytosis
    116590 (Mapk1)
   04062 Chemokine signaling pathway
    116590 (Mapk1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    116590 (Mapk1)
   04929 GnRH secretion
    116590 (Mapk1)
   04912 GnRH signaling pathway
    116590 (Mapk1)
   04915 Estrogen signaling pathway
    116590 (Mapk1)
   04914 Progesterone-mediated oocyte maturation
    116590 (Mapk1)
   04917 Prolactin signaling pathway
    116590 (Mapk1)
   04921 Oxytocin signaling pathway
    116590 (Mapk1)
   04926 Relaxin signaling pathway
    116590 (Mapk1)
   04935 Growth hormone synthesis, secretion and action
    116590 (Mapk1)
   04919 Thyroid hormone signaling pathway
    116590 (Mapk1)
   04928 Parathyroid hormone synthesis, secretion and action
    116590 (Mapk1)
   04916 Melanogenesis
    116590 (Mapk1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    116590 (Mapk1)
   04270 Vascular smooth muscle contraction
    116590 (Mapk1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    116590 (Mapk1)
  09156 Nervous system
   04724 Glutamatergic synapse
    116590 (Mapk1)
   04725 Cholinergic synapse
    116590 (Mapk1)
   04726 Serotonergic synapse
    116590 (Mapk1)
   04720 Long-term potentiation
    116590 (Mapk1)
   04730 Long-term depression
    116590 (Mapk1)
   04723 Retrograde endocannabinoid signaling
    116590 (Mapk1)
   04722 Neurotrophin signaling pathway
    116590 (Mapk1)
  09158 Development and regeneration
   04360 Axon guidance
    116590 (Mapk1)
   04380 Osteoclast differentiation
    116590 (Mapk1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    116590 (Mapk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116590 (Mapk1)
   05206 MicroRNAs in cancer
    116590 (Mapk1)
   05205 Proteoglycans in cancer
    116590 (Mapk1)
   05203 Viral carcinogenesis
    116590 (Mapk1)
   05230 Central carbon metabolism in cancer
    116590 (Mapk1)
   05231 Choline metabolism in cancer
    116590 (Mapk1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    116590 (Mapk1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    116590 (Mapk1)
   05212 Pancreatic cancer
    116590 (Mapk1)
   05225 Hepatocellular carcinoma
    116590 (Mapk1)
   05226 Gastric cancer
    116590 (Mapk1)
   05214 Glioma
    116590 (Mapk1)
   05216 Thyroid cancer
    116590 (Mapk1)
   05221 Acute myeloid leukemia
    116590 (Mapk1)
   05220 Chronic myeloid leukemia
    116590 (Mapk1)
   05218 Melanoma
    116590 (Mapk1)
   05211 Renal cell carcinoma
    116590 (Mapk1)
   05219 Bladder cancer
    116590 (Mapk1)
   05215 Prostate cancer
    116590 (Mapk1)
   05213 Endometrial cancer
    116590 (Mapk1)
   05224 Breast cancer
    116590 (Mapk1)
   05223 Non-small cell lung cancer
    116590 (Mapk1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    116590 (Mapk1)
   05170 Human immunodeficiency virus 1 infection
    116590 (Mapk1)
   05161 Hepatitis B
    116590 (Mapk1)
   05160 Hepatitis C
    116590 (Mapk1)
   05171 Coronavirus disease - COVID-19
    116590 (Mapk1)
   05164 Influenza A
    116590 (Mapk1)
   05163 Human cytomegalovirus infection
    116590 (Mapk1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    116590 (Mapk1)
   05165 Human papillomavirus infection
    116590 (Mapk1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    116590 (Mapk1)
   05135 Yersinia infection
    116590 (Mapk1)
   05133 Pertussis
    116590 (Mapk1)
   05152 Tuberculosis
    116590 (Mapk1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    116590 (Mapk1)
   05140 Leishmaniasis
    116590 (Mapk1)
   05142 Chagas disease
    116590 (Mapk1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    116590 (Mapk1)
   05020 Prion disease
    116590 (Mapk1)
   05022 Pathways of neurodegeneration - multiple diseases
    116590 (Mapk1)
  09165 Substance dependence
   05034 Alcoholism
    116590 (Mapk1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    116590 (Mapk1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    116590 (Mapk1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    116590 (Mapk1)
   04934 Cushing syndrome
    116590 (Mapk1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    116590 (Mapk1)
   01524 Platinum drug resistance
    116590 (Mapk1)
   01522 Endocrine resistance
    116590 (Mapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    116590 (Mapk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    116590 (Mapk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    116590 (Mapk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     116590 (Mapk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   116590 (Mapk1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     116590 (Mapk1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   116590 (Mapk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Choline_kinase Kdo Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 116590
NCBI-ProteinID: NP_446294
RGD: 70500
Ensembl: ENSRNOG00000001849
UniProt: P63086
Structure
PDB: 

Position
11
AA seq 358 aa
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQ
TYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLS
NDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTG
FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG
ILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRI
EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcccggagatggtccgcgggcaggtgttcgacgtgggg
ccgcgctacactaatctctcgtacatcggagaaggcgcctacggcatggtttgttctgct
tatgataatctcaacaaagttcgagttgctatcaagaaaatcagtccttttgagcaccag
acctactgtcagagaaccctgagagagataaaaatcctactgcgcttcagacatgagaac
atcatcggcatcaatgacatcatccgggcaccaaccattgagcagatgaaagatgtatat
atagtacaggacctcatggagacagatctttacaagctcttgaagacacagcacctcagc
aatgatcatatctgctattttctttatcagatcctgagaggattaaagtatatacattca
gctaatgttctgcaccgtgacctcaagccttccaacctcctgctgaacaccacttgtgat
ctcaagatctgtgactttggccttgcccgtgttgcagatccagaccatgatcatacaggg
ttcttgacagagtatgtagccacgcgttggtacagagctccagaaattatgttgaattcc
aagggttataccaagtccattgatatttggtctgtgggctgcatcctggcagagatgcta
tccaacaggcctatcttcccaggaaagcattaccttgaccagctgaatcacatcctgggt
attcttggatctccatcacaggaagatctgaattgtataataaatttaaaagctagaaac
tatttgctttctctcccgcacaaaaataaggtgccgtggaacaggttgttcccaaacgct
gactccaaagctctggatttactggataaaatgttgacatttaaccctcacaagaggatt
gaagttgaacaggctctggcccacccgtacctggagcagtattatgacccaagtgatgag
cccattgctgaagcaccattcaagtttgacatggagctggacgacttacctaaggagaag
ctcaaagaactcatttttgaagagactgctcgattccagccaggatacagatcttaa

KEGG   Rattus norvegicus (rat): 25272
Entry
25272             CDS       T01003                                 

Gene name
Mapk10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform 2
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04024  cAMP signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04141  Protein processing in endoplasmic reticulum
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04310  Wnt signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04530  Tight junction
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04910  Insulin signaling pathway
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04926  Relaxin signaling pathway
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05231  Choline metabolism in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    25272 (Mapk10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25272 (Mapk10)
   04012 ErbB signaling pathway
    25272 (Mapk10)
   04014 Ras signaling pathway
    25272 (Mapk10)
   04310 Wnt signaling pathway
    25272 (Mapk10)
   04668 TNF signaling pathway
    25272 (Mapk10)
   04068 FoxO signaling pathway
    25272 (Mapk10)
   04071 Sphingolipid signaling pathway
    25272 (Mapk10)
   04024 cAMP signaling pathway
    25272 (Mapk10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    25272 (Mapk10)
   04137 Mitophagy - animal
    25272 (Mapk10)
  09143 Cell growth and death
   04210 Apoptosis
    25272 (Mapk10)
   04215 Apoptosis - multiple species
    25272 (Mapk10)
   04217 Necroptosis
    25272 (Mapk10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25272 (Mapk10)
   04530 Tight junction
    25272 (Mapk10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    25272 (Mapk10)
   04621 NOD-like receptor signaling pathway
    25272 (Mapk10)
   04622 RIG-I-like receptor signaling pathway
    25272 (Mapk10)
   04625 C-type lectin receptor signaling pathway
    25272 (Mapk10)
   04660 T cell receptor signaling pathway
    25272 (Mapk10)
   04658 Th1 and Th2 cell differentiation
    25272 (Mapk10)
   04659 Th17 cell differentiation
    25272 (Mapk10)
   04657 IL-17 signaling pathway
    25272 (Mapk10)
   04664 Fc epsilon RI signaling pathway
    25272 (Mapk10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    25272 (Mapk10)
   04920 Adipocytokine signaling pathway
    25272 (Mapk10)
   04912 GnRH signaling pathway
    25272 (Mapk10)
   04914 Progesterone-mediated oocyte maturation
    25272 (Mapk10)
   04917 Prolactin signaling pathway
    25272 (Mapk10)
   04926 Relaxin signaling pathway
    25272 (Mapk10)
   04935 Growth hormone synthesis, secretion and action
    25272 (Mapk10)
  09156 Nervous system
   04728 Dopaminergic synapse
    25272 (Mapk10)
   04723 Retrograde endocannabinoid signaling
    25272 (Mapk10)
   04722 Neurotrophin signaling pathway
    25272 (Mapk10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    25272 (Mapk10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    25272 (Mapk10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25272 (Mapk10)
   05231 Choline metabolism in cancer
    25272 (Mapk10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    25272 (Mapk10)
   05212 Pancreatic cancer
    25272 (Mapk10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25272 (Mapk10)
   05170 Human immunodeficiency virus 1 infection
    25272 (Mapk10)
   05161 Hepatitis B
    25272 (Mapk10)
   05171 Coronavirus disease - COVID-19
    25272 (Mapk10)
   05162 Measles
    25272 (Mapk10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    25272 (Mapk10)
   05169 Epstein-Barr virus infection
    25272 (Mapk10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    25272 (Mapk10)
   05135 Yersinia infection
    25272 (Mapk10)
   05133 Pertussis
    25272 (Mapk10)
   05152 Tuberculosis
    25272 (Mapk10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    25272 (Mapk10)
   05142 Chagas disease
    25272 (Mapk10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    25272 (Mapk10)
   05012 Parkinson disease
    25272 (Mapk10)
   05016 Huntington disease
    25272 (Mapk10)
   05017 Spinocerebellar ataxia
    25272 (Mapk10)
   05020 Prion disease
    25272 (Mapk10)
   05022 Pathways of neurodegeneration - multiple diseases
    25272 (Mapk10)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    25272 (Mapk10)
   05418 Fluid shear stress and atherosclerosis
    25272 (Mapk10)
   05415 Diabetic cardiomyopathy
    25272 (Mapk10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    25272 (Mapk10)
   04932 Non-alcoholic fatty liver disease
    25272 (Mapk10)
   04931 Insulin resistance
    25272 (Mapk10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    25272 (Mapk10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    25272 (Mapk10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25272 (Mapk10)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     25272 (Mapk10)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   25272 (Mapk10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 Kinase-like RIO1 APH FTA2 TCAD9
Other DBs
NCBI-GeneID: 25272
NCBI-ProteinID: NP_036938
RGD: 3663
Ensembl: ENSRNOG00000002079
Vega: OTTRNOG00000002125
UniProt: P49187
Position
14
AA seq 426 aa
MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSK
MLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEV
MNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAG
PLGCCR
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgagcaaaagcaaggtagataaccagttctacagtgtggaagtgggagactcaaccttc
acagttctaaagcgctaccagaacctgaagccgatcggctctggggctcagggaatagtt
tgtgctgcgtatgacgctgtcctcgacagaaatgtggccattaagaagctcagcagaccc
ttccagaaccaaactcatgccaagagggcttaccgggagctggtcctcatgaagtgtgtg
aaccataaaaacattattagcttattaaatgtctttacaccccagaaaacactggaggag
ttccaagatgtttacttagtgatggaactgatggacgccaacttgtgtcaggtgattcag
atggagctggaccacgagcggatgtcgtacttgctgtaccagatgctgtgcggcatcaaa
cacctccactccgctgggatcatccacagggacttaaaacccagtaacatcgtagtcaag
tctgattgcacactgaaaatcctggactttggactggccaggacagcgggcacaagcttc
atgatgactccgtatgtggtgacgagatattacagagcccccgaggtcatcctgggcatg
ggctacaaggagaacgtggacatatggtctgtgggctgcatcatgggagaaatggttcgt
cacaaaatcctctttcccggaagggactatattgaccagtggaacaaagtcatagagcag
ctaggaactccgtgtccagaattcatgaagaaattgcagcccaccgtcagaaactacgtg
gagaaccggcccaagtatgcaggcctcaccttccccaagctctttccagattccctcttc
ccagcggattccgagcacaataaacttaaagccagccaagccagggacttgttgtcaaag
atgttagtgattgacccagcgaagaggatatcggtggatgacgcattgcagcatccgtac
atcaacgtttggtacgaccctgctgaagtggaggcgcctccgcctcagatatatgacaag
caactggatgaaagggagcacaccatcgaagaatggaaagaactcatctacaaggaagta
atgaactcagaagagaagactaagaacggcgtagtcaaaggccagccctcaccttcaggt
gcagcagtgaacagcagtgagagtctccctccatcctcgtctgtcaacgacatctcctcc
atgtccaccgaccagaccctcgcatccgacactgacagcagcctggaagcctcggcggga
ccgctgggttgttgcaggtga

KEGG   Rattus norvegicus (rat): 286997
Entry
286997            CDS       T01003                                 

Gene name
Mapk15
Definition
(RefSeq) mitogen-activated protein kinase 15
  KO
K19603  mitogen-activated protein kinase 15 [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    286997 (Mapk15)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    286997 (Mapk15)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     286997 (Mapk15)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   286997 (Mapk15)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kinase-like Haspin_kinase Kdo
Other DBs
NCBI-GeneID: 286997
NCBI-ProteinID: NP_775453
RGD: 628675
Ensembl: ENSRNOG00000009336
UniProt: Q9Z2A6
Position
7
AA seq 547 aa
MCAAEVDRHVSQRYLIKRRLGKGAYGIVWKAMDRRTGEVVAIKKIFDAFRDQTDAQRTFR
EIMLLREFGGHPNIIRLLDVIPAKNDRDIYLVFESMDTDLNAVIQKGRLLEDIHKRCIFY
QLLRATKFIHSGRVIHRDQKPANVLLDAACRVKLCDFGLARSLSDFPEGPGGQALTEYVA
TRWYRAPEVLLSSRWYTPGVDMWSLGCILGEMLRGQPLFPGTSTFHQLELILETIPLPSM
EELQGLGSDYSALILQNLGSRPRQTLDALLPPDTPPEALDLLKRLLAFAPDKRLSAEQAL
QHPYVQRFHCPDREWTRGSDVRLPVHEGDQLSAPEYRNRLYQMILERRRNSRSPREEDLG
VVASRAELRASQRQSLKPGVLPQVLAETPARKRGPKPQNGHGHDPEHVEVRRQSSDPLYQ
LPPPGSGERPPGATGEPPSAPSGVKTHVRAVAPSLTSQAAAQAANQPLIRSDPARGGGPR
AVGARRVPSRLPREAPEPRPGRRMFGISVSQGAQGAARAALGGYSQAYGTVCRSALGRLP
LLPGPRA
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgtgtgctgccgaggtggaccgtcatgtatcccagagatacctgatcaagcggaggctt
gggaagggggcctacggcattgtatggaaggccatggaccggaggactggtgaggtagtg
gccatcaagaaaatctttgatgcctttagggaccagacagatgctcagaggaccttccgt
gaaatcatgcttctccgggagtttgggggccatcccaacatcatccgcctgcttgatgta
atcccagcaaagaatgacagggatatttacctggtgtttgagtccatggacaccgacctg
aacgcggtcatccagaagggcagactgttggaggacatccacaaacgttgcatcttttac
cagctcctgagagccaccaagtttatccattcagggcgcgtcattcaccgggaccagaag
ccagccaacgttctattggatgctgcttgccgggtgaaactatgtgactttggcctggca
cgctccctcagtgacttccctgaagggcctgggggccaggccctgacagaatatgtggcc
acacgctggtaccgagctccagaggtgcttctgtcttcccgatggtatacccctggggtg
gacatgtggagcctgggctgcatactgggagagatgcttcgagggcagccactgtttccg
ggtacatctactttccaccagctggagctgatcctggagaccattccattgccctccatg
gaggagctccagggccttggatcagactacagtgctttgattctgcagaatcttggatcc
aggccacggcagacgctggacgccctcctgccgccagacacccccccagaagccctggac
ctcctcaagcgactcttggcatttgctccggacaaacggcttagtgcagagcaggctctt
caacacccttacgtgcagagattccattgccccgaccgcgagtggacacgggggtccgat
gtgcggctcccggtacacgaaggagaccagctctctgcaccagagtatcgcaaccgcctg
taccagatgatcctggagcggagacggaacagccgcagccctcgagaggaagacttgggg
gttgtggcctcgcgggcagagctcagggcttcccagaggcaatcgctcaagcccggagtc
ctcccccaggtcttggcggagacgcctgcgcggaaacgcggacccaaacctcagaatggc
catggtcacgatcccgagcatgtggaagttcgcaggcagagttcagaccccctgtaccaa
cttccgccgccaggcagcggggaaaggcccccaggggccacaggggagccaccctccgca
ccctcaggggtgaagactcacgttagggcggtggcgccctccctgacttcacaggccgcg
gctcaggcggccaatcagcctctgatccgcagtgatccggcccggggcggtgggccaagg
gctgtcggcgcgcgacgggtcccttcccgcctgccccgggaggccccggaaccccgaccc
ggccgaaggatgtttggcatctcggtctcgcagggggcccagggtgcagccagagctgct
cttggcggctactcccaggcctacgggaccgtgtgccgctccgcgctgggccgcctgcct
ctgctccccggaccgcgtgcgtga

KEGG   Rattus norvegicus (rat): 29513
Entry
29513             CDS       T01003                                 

Gene name
Mapk13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04015  Rap1 signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04714  Thermogenesis
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05205  Proteoglycans in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29513 (Mapk13)
   04015 Rap1 signaling pathway
    29513 (Mapk13)
   04370 VEGF signaling pathway
    29513 (Mapk13)
   04668 TNF signaling pathway
    29513 (Mapk13)
   04068 FoxO signaling pathway
    29513 (Mapk13)
   04071 Sphingolipid signaling pathway
    29513 (Mapk13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    29513 (Mapk13)
   04218 Cellular senescence
    29513 (Mapk13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    29513 (Mapk13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    29513 (Mapk13)
   04613 Neutrophil extracellular trap formation
    29513 (Mapk13)
   04620 Toll-like receptor signaling pathway
    29513 (Mapk13)
   04621 NOD-like receptor signaling pathway
    29513 (Mapk13)
   04622 RIG-I-like receptor signaling pathway
    29513 (Mapk13)
   04625 C-type lectin receptor signaling pathway
    29513 (Mapk13)
   04660 T cell receptor signaling pathway
    29513 (Mapk13)
   04658 Th1 and Th2 cell differentiation
    29513 (Mapk13)
   04659 Th17 cell differentiation
    29513 (Mapk13)
   04657 IL-17 signaling pathway
    29513 (Mapk13)
   04664 Fc epsilon RI signaling pathway
    29513 (Mapk13)
   04670 Leukocyte transendothelial migration
    29513 (Mapk13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    29513 (Mapk13)
   04914 Progesterone-mediated oocyte maturation
    29513 (Mapk13)
   04917 Prolactin signaling pathway
    29513 (Mapk13)
   04926 Relaxin signaling pathway
    29513 (Mapk13)
   04935 Growth hormone synthesis, secretion and action
    29513 (Mapk13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    29513 (Mapk13)
  09156 Nervous system
   04728 Dopaminergic synapse
    29513 (Mapk13)
   04723 Retrograde endocannabinoid signaling
    29513 (Mapk13)
   04722 Neurotrophin signaling pathway
    29513 (Mapk13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    29513 (Mapk13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    29513 (Mapk13)
  09159 Environmental adaptation
   04714 Thermogenesis
    29513 (Mapk13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    29513 (Mapk13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    29513 (Mapk13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    29513 (Mapk13)
   05161 Hepatitis B
    29513 (Mapk13)
   05171 Coronavirus disease - COVID-19
    29513 (Mapk13)
   05163 Human cytomegalovirus infection
    29513 (Mapk13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    29513 (Mapk13)
   05169 Epstein-Barr virus infection
    29513 (Mapk13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    29513 (Mapk13)
   05135 Yersinia infection
    29513 (Mapk13)
   05133 Pertussis
    29513 (Mapk13)
   05152 Tuberculosis
    29513 (Mapk13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    29513 (Mapk13)
   05140 Leishmaniasis
    29513 (Mapk13)
   05142 Chagas disease
    29513 (Mapk13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    29513 (Mapk13)
   05020 Prion disease
    29513 (Mapk13)
   05022 Pathways of neurodegeneration - multiple diseases
    29513 (Mapk13)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    29513 (Mapk13)
   05418 Fluid shear stress and atherosclerosis
    29513 (Mapk13)
   05415 Diabetic cardiomyopathy
    29513 (Mapk13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    29513 (Mapk13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    29513 (Mapk13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29513 (Mapk13)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     29513 (Mapk13)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   29513 (Mapk13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 RIO1 APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 29513
NCBI-ProteinID: NP_062104
RGD: 3045
Ensembl: ENSRNOG00000000515
Vega: OTTRNOG00000001972
UniProt: Q32Q45
Position
20
AA seq 366 aa
MSLIRKRGFYKQDINKTAWELPKTYLAPAHVGSGAYGAVCSAIDKRTGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMHHENVIGLLDVYTPATSVRNFQDFYLVMPFMQTDLQKIMGM
EFSEEKVQYLVYQMLKGLKYIHSAGIVHRDLKPGNLAVNEDCELKILDFGLARHTDAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGAEFVQKLKDKAAKSYIQSLPQSPKKDFTQLFPRASPQAVDLLDKMLELDVDKRLTAA
QALAHPFFEPFRDPEEETEAQQPFDDALEREKLSVDEWKQHIYKEIANFSPIARKDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgagcctcattcggaaaaggggcttctacaagcaggacatcaacaagactgcctgggag
ctgcccaagacctacctggcgcccgcgcacgtcggcagcggggcctatggcgcggtgtgc
tcggccatcgacaagcggacaggggagaaggtggccatcaagaagctgagccggcccttc
cagtcggagatctttgccaagcgcgcttaccgcgaactcctgctgttgaagcacatgcac
catgagaacgtcattgggcttctggatgtctacacacctgccacttccgttcgaaacttc
caagatttctacctggtgatgcctttcatgcagaccgacctgcagaagataatggggatg
gagttcagtgaggagaaggtccagtatttggtgtaccagatgctcaaaggtctaaagtac
atccactcagctggtatcgttcacagggacctgaagccaggcaacctggccgtgaatgaa
gactgtgagctgaagatcctggactttgggctggcacgccacacggacgcggagatgact
ggctatgtggtgacccgctggtaccgggctcctgaggtgatcctcagctggatgcattac
aaccagacggtggatatctggtctgttggctgcatcatggccgagatgctaaccggaaag
acactcttcaagggtaaggactacctggaccagctgacccagatcctgaaagtgactggg
gtgccaggtgccgagttcgtgcagaagctgaaagacaaggcggccaaatcctacattcag
tccctgccccagagccccaagaaggatttcacacagcttttcccacgcgccagcccgcaa
gctgtagacctgctggacaagatgctggagctggacgtggacaagcgtctgaccgctgct
caggcactcgctcaccccttctttgaacccttccgggaccctgaggaggagacagaggcc
cagcagccatttgatgatgccttagagcgggagaaactcagcgtggacgaatggaaacaa
cacatctacaaagagatcgccaacttcagtcccatagcccggaaggactcgaggcgacga
agtgggatgaagctgcagtga

KEGG   Rattus norvegicus (rat): 50658
Entry
50658             CDS       T01003                                 

Gene name
Mapk9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform 2
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04024  cAMP signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04141  Protein processing in endoplasmic reticulum
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04310  Wnt signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04530  Tight junction
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04910  Insulin signaling pathway
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04926  Relaxin signaling pathway
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05231  Choline metabolism in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    50658 (Mapk9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    50658 (Mapk9)
   04012 ErbB signaling pathway
    50658 (Mapk9)
   04014 Ras signaling pathway
    50658 (Mapk9)
   04310 Wnt signaling pathway
    50658 (Mapk9)
   04668 TNF signaling pathway
    50658 (Mapk9)
   04068 FoxO signaling pathway
    50658 (Mapk9)
   04071 Sphingolipid signaling pathway
    50658 (Mapk9)
   04024 cAMP signaling pathway
    50658 (Mapk9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    50658 (Mapk9)
   04137 Mitophagy - animal
    50658 (Mapk9)
  09143 Cell growth and death
   04210 Apoptosis
    50658 (Mapk9)
   04215 Apoptosis - multiple species
    50658 (Mapk9)
   04217 Necroptosis
    50658 (Mapk9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    50658 (Mapk9)
   04530 Tight junction
    50658 (Mapk9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    50658 (Mapk9)
   04621 NOD-like receptor signaling pathway
    50658 (Mapk9)
   04622 RIG-I-like receptor signaling pathway
    50658 (Mapk9)
   04625 C-type lectin receptor signaling pathway
    50658 (Mapk9)
   04660 T cell receptor signaling pathway
    50658 (Mapk9)
   04658 Th1 and Th2 cell differentiation
    50658 (Mapk9)
   04659 Th17 cell differentiation
    50658 (Mapk9)
   04657 IL-17 signaling pathway
    50658 (Mapk9)
   04664 Fc epsilon RI signaling pathway
    50658 (Mapk9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    50658 (Mapk9)
   04920 Adipocytokine signaling pathway
    50658 (Mapk9)
   04912 GnRH signaling pathway
    50658 (Mapk9)
   04914 Progesterone-mediated oocyte maturation
    50658 (Mapk9)
   04917 Prolactin signaling pathway
    50658 (Mapk9)
   04926 Relaxin signaling pathway
    50658 (Mapk9)
   04935 Growth hormone synthesis, secretion and action
    50658 (Mapk9)
  09156 Nervous system
   04728 Dopaminergic synapse
    50658 (Mapk9)
   04723 Retrograde endocannabinoid signaling
    50658 (Mapk9)
   04722 Neurotrophin signaling pathway
    50658 (Mapk9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    50658 (Mapk9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    50658 (Mapk9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    50658 (Mapk9)
   05231 Choline metabolism in cancer
    50658 (Mapk9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    50658 (Mapk9)
   05212 Pancreatic cancer
    50658 (Mapk9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    50658 (Mapk9)
   05170 Human immunodeficiency virus 1 infection
    50658 (Mapk9)
   05161 Hepatitis B
    50658 (Mapk9)
   05171 Coronavirus disease - COVID-19
    50658 (Mapk9)
   05162 Measles
    50658 (Mapk9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    50658 (Mapk9)
   05169 Epstein-Barr virus infection
    50658 (Mapk9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    50658 (Mapk9)
   05135 Yersinia infection
    50658 (Mapk9)
   05133 Pertussis
    50658 (Mapk9)
   05152 Tuberculosis
    50658 (Mapk9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    50658 (Mapk9)
   05142 Chagas disease
    50658 (Mapk9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    50658 (Mapk9)
   05012 Parkinson disease
    50658 (Mapk9)
   05016 Huntington disease
    50658 (Mapk9)
   05017 Spinocerebellar ataxia
    50658 (Mapk9)
   05020 Prion disease
    50658 (Mapk9)
   05022 Pathways of neurodegeneration - multiple diseases
    50658 (Mapk9)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    50658 (Mapk9)
   05418 Fluid shear stress and atherosclerosis
    50658 (Mapk9)
   05415 Diabetic cardiomyopathy
    50658 (Mapk9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    50658 (Mapk9)
   04932 Non-alcoholic fatty liver disease
    50658 (Mapk9)
   04931 Insulin resistance
    50658 (Mapk9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    50658 (Mapk9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    50658 (Mapk9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    50658 (Mapk9)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     50658 (Mapk9)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   50658 (Mapk9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo RIO1 APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 50658
NCBI-ProteinID: NP_001257473
RGD: 628847
Ensembl: ENSRNOG00000002823
UniProt: P49186 Q6P727 D4A5V8
Position
10
AA seq 423 aa
MSDSKSDGQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMAEMVLHKVLFPGRDYIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVKDQPSDAAVSSKATPSQSSSINDISSMSTEHTLASDTDSSLDASTGPLE
GCR
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaaagcgatggccagttttacagtgtgcaagtggcagactcaactttc
actgttctaaaacgttaccagcagttgaaaccaattggctctggagcccaaggaattgtt
tgtgctgcttttgatacagttcttggaataaatgttgctgtcaagaagttaagtcgtcct
tttcagaaccaaacgcatgcaaagagagcctaccgtgaacttgtcctcctaaagtgtgtc
aatcataaaaatataattagcttgttaaatgtgttcacaccacaaaaaacgctagaagaa
ttccaagatgtgtacttggttatggagttaatggacgctaacttatgtcaggttattcat
atggagctggaccatgaaagaatgtcatacctcctctaccagatgctttgtggcattaag
cacctgcattcagctggcataattcatagggatttgaagcctagcaacattgtagtaaaa
tcagactgtactctcaagatccttgactttggcctggcacggacagcctgtaccaacttt
atgatgactccctatgtggtaactcgctactatcgggctccagaagtcatcctgggcatg
ggctacaaggagaatgtggacatctggtctgtcgggtgcatcatggcagaaatggtcctc
cataaagtcctgttcccaggaagagactatattgatcaatggaataaagttattgaacag
ctaggaacaccatccgcagagttcatgaagaaacttcagccaactgtaaggaattatgtg
gaaaacagaccaaagtaccctggaatcaaatttgaagagctctttccagattggatattt
ccgtcagaatccgaacgagacaaaataaaaacaagtcaagccagagatctgttatcgaaa
atgttagtgattgatccggacaagcggatctctgtggacgaagccttgcgccacccgtat
attactgtttggtatgaccccgctgaagcagaagcgccaccacctcaaatttatgatgcc
cagttggaagaaagagagcatgcgattgaagagtggaaagaactaatttacaaagaagtg
atggactgggaagaaagaagcaagaatggggtgaaagaccagccttcagatgcagcagta
agcagcaaggctactccttctcagtcgtcatccatcaatgacatctcatccatgtccact
gagcacaccctggcctcagacacagacagcagtctcgatgcctcaaccggacccctggaa
ggctgccgatga

KEGG   Rattus norvegicus (rat): 50689
Entry
50689             CDS       T01003                                 

Gene name
Mapk3
Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno01524  Platinum drug resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04114  Oocyte meiosis
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04350  TGF-beta signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04371  Apelin signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04520  Adherens junction
rno04540  Gap junction
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04668  TNF signaling pathway
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04730  Long-term depression
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04926  Relaxin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04929  GnRH secretion
rno04930  Type II diabetes mellitus
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04960  Aldosterone-regulated sodium reabsorption
rno05010  Alzheimer disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05034  Alcoholism
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05216  Thyroid cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    50689 (Mapk3)
   04012 ErbB signaling pathway
    50689 (Mapk3)
   04014 Ras signaling pathway
    50689 (Mapk3)
   04015 Rap1 signaling pathway
    50689 (Mapk3)
   04350 TGF-beta signaling pathway
    50689 (Mapk3)
   04370 VEGF signaling pathway
    50689 (Mapk3)
   04371 Apelin signaling pathway
    50689 (Mapk3)
   04668 TNF signaling pathway
    50689 (Mapk3)
   04066 HIF-1 signaling pathway
    50689 (Mapk3)
   04068 FoxO signaling pathway
    50689 (Mapk3)
   04072 Phospholipase D signaling pathway
    50689 (Mapk3)
   04071 Sphingolipid signaling pathway
    50689 (Mapk3)
   04024 cAMP signaling pathway
    50689 (Mapk3)
   04022 cGMP-PKG signaling pathway
    50689 (Mapk3)
   04151 PI3K-Akt signaling pathway
    50689 (Mapk3)
   04150 mTOR signaling pathway
    50689 (Mapk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    50689 (Mapk3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    50689 (Mapk3)
   04210 Apoptosis
    50689 (Mapk3)
   04218 Cellular senescence
    50689 (Mapk3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    50689 (Mapk3)
   04520 Adherens junction
    50689 (Mapk3)
   04540 Gap junction
    50689 (Mapk3)
   04550 Signaling pathways regulating pluripotency of stem cells
    50689 (Mapk3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    50689 (Mapk3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    50689 (Mapk3)
   04613 Neutrophil extracellular trap formation
    50689 (Mapk3)
   04620 Toll-like receptor signaling pathway
    50689 (Mapk3)
   04621 NOD-like receptor signaling pathway
    50689 (Mapk3)
   04625 C-type lectin receptor signaling pathway
    50689 (Mapk3)
   04650 Natural killer cell mediated cytotoxicity
    50689 (Mapk3)
   04660 T cell receptor signaling pathway
    50689 (Mapk3)
   04658 Th1 and Th2 cell differentiation
    50689 (Mapk3)
   04659 Th17 cell differentiation
    50689 (Mapk3)
   04657 IL-17 signaling pathway
    50689 (Mapk3)
   04662 B cell receptor signaling pathway
    50689 (Mapk3)
   04664 Fc epsilon RI signaling pathway
    50689 (Mapk3)
   04666 Fc gamma R-mediated phagocytosis
    50689 (Mapk3)
   04062 Chemokine signaling pathway
    50689 (Mapk3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    50689 (Mapk3)
   04929 GnRH secretion
    50689 (Mapk3)
   04912 GnRH signaling pathway
    50689 (Mapk3)
   04915 Estrogen signaling pathway
    50689 (Mapk3)
   04914 Progesterone-mediated oocyte maturation
    50689 (Mapk3)
   04917 Prolactin signaling pathway
    50689 (Mapk3)
   04921 Oxytocin signaling pathway
    50689 (Mapk3)
   04926 Relaxin signaling pathway
    50689 (Mapk3)
   04935 Growth hormone synthesis, secretion and action
    50689 (Mapk3)
   04919 Thyroid hormone signaling pathway
    50689 (Mapk3)
   04928 Parathyroid hormone synthesis, secretion and action
    50689 (Mapk3)
   04916 Melanogenesis
    50689 (Mapk3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    50689 (Mapk3)
   04270 Vascular smooth muscle contraction
    50689 (Mapk3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    50689 (Mapk3)
  09156 Nervous system
   04724 Glutamatergic synapse
    50689 (Mapk3)
   04725 Cholinergic synapse
    50689 (Mapk3)
   04726 Serotonergic synapse
    50689 (Mapk3)
   04720 Long-term potentiation
    50689 (Mapk3)
   04730 Long-term depression
    50689 (Mapk3)
   04723 Retrograde endocannabinoid signaling
    50689 (Mapk3)
   04722 Neurotrophin signaling pathway
    50689 (Mapk3)
  09158 Development and regeneration
   04360 Axon guidance
    50689 (Mapk3)
   04380 Osteoclast differentiation
    50689 (Mapk3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    50689 (Mapk3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    50689 (Mapk3)
   05206 MicroRNAs in cancer
    50689 (Mapk3)
   05205 Proteoglycans in cancer
    50689 (Mapk3)
   05203 Viral carcinogenesis
    50689 (Mapk3)
   05230 Central carbon metabolism in cancer
    50689 (Mapk3)
   05231 Choline metabolism in cancer
    50689 (Mapk3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    50689 (Mapk3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    50689 (Mapk3)
   05212 Pancreatic cancer
    50689 (Mapk3)
   05225 Hepatocellular carcinoma
    50689 (Mapk3)
   05226 Gastric cancer
    50689 (Mapk3)
   05214 Glioma
    50689 (Mapk3)
   05216 Thyroid cancer
    50689 (Mapk3)
   05221 Acute myeloid leukemia
    50689 (Mapk3)
   05220 Chronic myeloid leukemia
    50689 (Mapk3)
   05218 Melanoma
    50689 (Mapk3)
   05211 Renal cell carcinoma
    50689 (Mapk3)
   05219 Bladder cancer
    50689 (Mapk3)
   05215 Prostate cancer
    50689 (Mapk3)
   05213 Endometrial cancer
    50689 (Mapk3)
   05224 Breast cancer
    50689 (Mapk3)
   05223 Non-small cell lung cancer
    50689 (Mapk3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    50689 (Mapk3)
   05170 Human immunodeficiency virus 1 infection
    50689 (Mapk3)
   05161 Hepatitis B
    50689 (Mapk3)
   05160 Hepatitis C
    50689 (Mapk3)
   05171 Coronavirus disease - COVID-19
    50689 (Mapk3)
   05164 Influenza A
    50689 (Mapk3)
   05163 Human cytomegalovirus infection
    50689 (Mapk3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    50689 (Mapk3)
   05165 Human papillomavirus infection
    50689 (Mapk3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    50689 (Mapk3)
   05135 Yersinia infection
    50689 (Mapk3)
   05133 Pertussis
    50689 (Mapk3)
   05152 Tuberculosis
    50689 (Mapk3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    50689 (Mapk3)
   05140 Leishmaniasis
    50689 (Mapk3)
   05142 Chagas disease
    50689 (Mapk3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    50689 (Mapk3)
   05020 Prion disease
    50689 (Mapk3)
   05022 Pathways of neurodegeneration - multiple diseases
    50689 (Mapk3)
  09165 Substance dependence
   05034 Alcoholism
    50689 (Mapk3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    50689 (Mapk3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    50689 (Mapk3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    50689 (Mapk3)
   04934 Cushing syndrome
    50689 (Mapk3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    50689 (Mapk3)
   01524 Platinum drug resistance
    50689 (Mapk3)
   01522 Endocrine resistance
    50689 (Mapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    50689 (Mapk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    50689 (Mapk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    50689 (Mapk3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     50689 (Mapk3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   50689 (Mapk3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     50689 (Mapk3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   50689 (Mapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Choline_kinase Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 50689
NCBI-ProteinID: NP_059043
RGD: 3046
Ensembl: ENSRNOG00000053583
UniProt: P21708
Position
1
AA seq 380 aa
MAAAAAAPGGGGGEPRGTAGVVPVVPGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSA
YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETARFQPGAPEAP
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggctccggggggcgggggcggggagcccaggggaactgctggg
gtcgtcccggtggtccccggggaggtggaggtggtgaaggggcagccattcgacgtgggc
ccacgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagca
tatgaccacgtgcgcaagaccagagtggctatcaagaagatcagccccttcgagcatcaa
acctactgtcagcgcacgctgagagaaatccagatcttgctgcgattccgccatgagaat
gtcataggcatccgagacatcctcagagcacccaccctggaagccatgagagatgtttac
attgttcaggacctcatggagacggacctgtacaagctgctaaagagccagcagctgagc
aatgaccacatctgctacttcctctaccagatcctccggggcctcaagtacatacactcg
gccaatgtgctgcaccgggacctgaagccctccaatctgcttatcaacaccacctgcgac
cttaagatctgtgattttggccttgcccggattgctgaccctgagcacgaccacactggc
tttcttaccgagtatgtggccacacgctggtaccgagccccagagatcatgcttaactcc
aagggctacaccaaatccattgacatctggtctgtgggctgcattctggctgagatgctc
tccaaccggcctatcttccccggcaagcactacctggaccagctcaaccacattctaggt
atactgggttccccatcccaagaggacctaaattgtatcattaacatgaaggcccgaaac
tacctacagtctctgccctctaaaaccaaggtggcttgggccaagctttttcccaaatct
gactccaaagctcttgacctgctggaccggatgttaacctttaacccaaacaagcgcatc
acagtagaggaagcactggctcacccttacctggaacagtactatgatccgacagatgaa
ccagtggctgaggagccattcacctttgacatggagctggatgatctccccaaggagcgg
ctgaaggagctgatcttccaagagacagcccgcttccagccaggggcaccagaggccccc
taa

KEGG   Rattus norvegicus (rat): 54268
Entry
54268             CDS       T01003                                 

Gene name
Mapk4
Definition
(RefSeq) mitogen-activated protein kinase 4
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    54268 (Mapk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    54268 (Mapk4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     54268 (Mapk4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   54268 (Mapk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1
Other DBs
NCBI-GeneID: 54268
NCBI-ProteinID: NP_062192
RGD: 3047
Ensembl: ENSRNOG00000015401
UniProt: G3V9J9
Position
18
AA seq 583 aa
MAEKGDCIASVYGYDLGGRFTDFQPLGFGVNGLVLSATDSRACRKVAVKKIVLSDARSMK
HALREIKIIRRLDHDNIVKVYEVLGPKGSDLQGELFKFSVAYIVQEYMETDLACLLEQGT
LTEEHAKLFMYQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGLARIADQHYS
HKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGKMLFAGAHELEQMQL
ILDTIPVVREEDKEELLRVMPSFVSSTWEVKRPLRKLLPDVNREAIDFLEKILTFNPMDR
LTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDDLVLMAASQSQLSNWDRYPVSLSSD
LEWRPDRCQDASEVQRDPRAGSTPLAEDVQVDPRKDSQSSSERFLEQSHSSMERAFEADY
GRSCDYKVGSPSYLDKLLWRDNKPHHYSEPKLILDLSHWKQAASAPPRAAVAADPVSRED
EPASLFLEIAQWVKSTQGGPERASPPPDAPEPRLSASPPGHPTPIDGGASPQFDLDVFIS
RALKLCTKPEDLPENKLGDLNGACISEHPGDLVQTEAFSKERW
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggcagagaaaggtgactgcatcgccagtgtctacgggtacgaccttggtgggcgcttc
actgacttccaacccctcggcttcggggtcaacgggctggtgctgtcggctacggacagc
agggcttgccggaaggtagccgtgaagaagattgtgctgagtgacgcacgaagcatgaag
cacgcgctccgagagatcaaaatcatccggcgcctggaccacgacaacatcgtcaaagtg
tacgaggtactgggacccaagggtagcgatctgcagggcgagctctttaagttcagcgtg
gcttatattgtccaagagtacatggagactgacctggcatgcctgctagagcagggcacg
ctgaccgaggagcacgctaagctattcatgtaccagctgctgcgtgggctcaagtacatc
cactctgccaacgtgttgcacagggacctgaagcccgccaacattttcatcagcacggag
gacctcgtgctgaagatcggggatttcgggctggccagaatcgcggaccagcattactcc
cacaagggttatctgtcggaagggttggtgacaaagtggtaccgctctccacgactgctc
ctgtccccgaacaactacacgaaagccatcgatatgtgggcagctggctgcatcctagcg
gagatgctcacggggaaaatgctctttgctggggctcacgagcttgagcagatgcagctc
atcctagacaccatccctgtagtgcgggaggaagacaaggaggagctgctcagggtgatg
ccgtcctttgtcagcagcacttgggaggtgaagaggccactgcgtaagctactcccggat
gtcaaccgtgaagccattgactttctggagaagatcctgacctttaaccccatggaccgc
ctaacagctgagatggggctacagcatccttacatgagcccgtattcgtgccccgaggat
gagcccacctcacaacaccccttccgcattgaagacgagatcgacgacctcgtactgatg
gctgccagtcagagccagctctccaactgggacaggtatcccgtgagcctgtcgtcagat
ctggaatggcggcctgaccgctgtcaggacgcgagcgaggtgcagcgcgacccacgtgct
ggctctactccgctggcggaggatgttcaggtggacccacgcaaggactcacagagcagc
tccgagcgcttcctggagcagtcgcactcgtccatggagcgcgcctttgaggccgactat
ggacggtcctgcgactacaaagtggggtctccgtcctacctggacaagctgctgtggcgc
gacaacaagccccaccactactcggaacccaagctcatcctggacctgtcgcactggaag
caggcggccagcgcaccccccagggctgcagtagcagcagacccagtgtcacgtgaggat
gagccagcaagcctctttctggagatcgcgcagtgggtcaagagcacacaaggtggccct
gagcgtgccagtcctccccctgatgccccagagccccgtctctctgcttcacccccggga
cacccaacacccattgatgggggtgccagtccccaattcgacttagatgtgttcatctcg
cgtgccctaaagctctgcaccaaacctgaggacctaccggaaaacaaactgggcgacctg
aatggtgcgtgcatctccgagcaccccggcgacctcgtgcaaacagaggccttctccaaa
gaaaggtggtga

KEGG   Rattus norvegicus (rat): 58840
Entry
58840             CDS       T01003                                 

Gene name
Mapk6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    58840 (Mapk6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    58840 (Mapk6)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     58840 (Mapk6)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   58840 (Mapk6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH ABC1
Other DBs
NCBI-GeneID: 58840
NCBI-ProteinID: NP_113810
RGD: 62087
Ensembl: ENSRNOG00000009381
UniProt: P27704
Position
8
AA seq 720 aa
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPTDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDC
QFSEHDWPIHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTSYS
AEPCWQYPDHHENKYCDLECSHTCNYKTRSPSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKDKSDKRGKSKCERNGLVKAQIALEEASQQLAERERGQGFDFDAFIAGTVQLSAQRE
SADVVDKLNDLNSSVSQLEMKSLISKSVSREKQEKGRANLAQLGALYQPSWESQFVSGGE
ECFLISQFCCEVRKDEHVEKENTYTSYLDKFFSRKEDSEMLETEPVEEGKRGERGREAGL
LSSGGEFLLSRQLESIGTPQFHSPGGSPLKSIQATLTPSAMKSSPQIPHKTYSNILKHLN
NT seq 2163 nt   +upstreamnt  +downstreamnt
atggcagagaaatttgaaagtctcatgaacattcatggctttgatctgggttccaggtac
atggacttaaaaccattgggctgtggaggcaatggcttggttttttctgctgtagacaat
gactgtgacaaaagagtagccatcaagaaaattgtcctcaccgatccccagagtgtcaaa
catgccctccgtgaaatcaaaattattagaagacttgaccacgataacattgtgaaagtg
tttgaaattcttggtcccagtggaagccagctgacagacgatgtgggctctctaacagag
ctgaatagcgtctacattgttcaggagtacatggagacagacttggcgaacgtgctggag
cagggccctttactggaggagcatgccaggctcttcatgtaccagctgctgcgtgggctc
aagtacatccactctgcaaacgtgctgcacagggatctcaagccggccaaccttttcatt
aacactgaagacttggtgctgaagattggtgactttggcctggcccggatcatggatcct
cattattcccataagggtcatctttctgaaggattggttaccaaatggtacagatctcca
cggcttttactttctcctaataactatactaaagccattgacatgtgggctgcaggctgc
atctttgctgaaatgctgactggtaaaaccctctttgcaggtgcacatgaacttgaacag
atgcagctgatcttggagtctatccctgttgtgcacgaggaagatcggcaggagcttctc
agcgtgattccagtttacattagaaacgacatgactgagccacacaaaccgctgactcag
ctgcttccggggattagtcgggaagcactggatttcctggaacagattctgacgttcagt
cccatggaccggctgacagccgaggaagcactttcccatccttacatgagcatctactct
ttcccaacggacgagcctatttccagccatcctttccacatagaagacgaagtggacgac
attttgctaatggatgaaacacacagtcacatttataactgggaaaggtaccacgattgt
cagttctcggagcatgactggcctattcataacaactttgatatcgatgaggttcagctt
gacccgagagctctgtctgatgtcaccgatgaagaagaagttcaagttgatcctcgaaag
tacttggatggagaccgagagaagtatctggaggatcccgccttcgacaccagctactct
gctgagccttgctggcagtacccagatcaccacgagaacaagtactgtgatctggagtgt
agccacacctgtaactacaaaacaaggtcgccatcatacttagataacctggtgtggagg
gagagcgaggttaaccattactatgagcccaagcttattatagatctttccaactggaaa
gagcaaagtaaggacaaatccgacaagagaggcaagtccaagtgtgagaggaacgggttg
gtcaaggcgcagattgcgcttgaggaagcgtcccagcagctggctgagagggagaggggc
caaggctttgactttgatgccttcatcgcaggcaccgttcagctcagtgcccagcgtgag
tctgctgacgtagttgacaagttaaacgacttgaatagctcagtgtcccagctagaaatg
aaaagcctgatatccaagtcagtcagccgagaaaagcaagaaaagggaagggctaacctg
gcccagctgggagccttgtaccagccctcctgggagagccagtttgtgagtggcggggag
gagtgcttccttatcagtcagttttgttgtgaggtcaggaaggacgaacacgtggagaag
gagaacacttacaccagctatttggacaagttttttagcaggaaggaggattctgaaatg
ctagaaactgagccagtggaagaagggaagcgtggggagagaggccgtgaggcagggctt
ctgagcagcggtggggagtttctcctgagcaggcagctagagtccataggcaccccgcag
ttccacagtccagggggatccccactcaagtccatccaggccacgttaacaccttccgct
atgaaatcttcccctcaaatccctcacaagacatacagcaacattctgaaacatctgaac
taa

KEGG   Rattus norvegicus (rat): 60352
Entry
60352             CDS       T01003                                 

Gene name
Mapk12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04015  Rap1 signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04714  Thermogenesis
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05205  Proteoglycans in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    60352 (Mapk12)
   04015 Rap1 signaling pathway
    60352 (Mapk12)
   04370 VEGF signaling pathway
    60352 (Mapk12)
   04668 TNF signaling pathway
    60352 (Mapk12)
   04068 FoxO signaling pathway
    60352 (Mapk12)
   04071 Sphingolipid signaling pathway
    60352 (Mapk12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    60352 (Mapk12)
   04218 Cellular senescence
    60352 (Mapk12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    60352 (Mapk12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    60352 (Mapk12)
   04613 Neutrophil extracellular trap formation
    60352 (Mapk12)
   04620 Toll-like receptor signaling pathway
    60352 (Mapk12)
   04621 NOD-like receptor signaling pathway
    60352 (Mapk12)
   04622 RIG-I-like receptor signaling pathway
    60352 (Mapk12)
   04625 C-type lectin receptor signaling pathway
    60352 (Mapk12)
   04660 T cell receptor signaling pathway
    60352 (Mapk12)
   04658 Th1 and Th2 cell differentiation
    60352 (Mapk12)
   04659 Th17 cell differentiation
    60352 (Mapk12)
   04657 IL-17 signaling pathway
    60352 (Mapk12)
   04664 Fc epsilon RI signaling pathway
    60352 (Mapk12)
   04670 Leukocyte transendothelial migration
    60352 (Mapk12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    60352 (Mapk12)
   04914 Progesterone-mediated oocyte maturation
    60352 (Mapk12)
   04917 Prolactin signaling pathway
    60352 (Mapk12)
   04926 Relaxin signaling pathway
    60352 (Mapk12)
   04935 Growth hormone synthesis, secretion and action
    60352 (Mapk12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    60352 (Mapk12)
  09156 Nervous system
   04728 Dopaminergic synapse
    60352 (Mapk12)
   04723 Retrograde endocannabinoid signaling
    60352 (Mapk12)
   04722 Neurotrophin signaling pathway
    60352 (Mapk12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    60352 (Mapk12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    60352 (Mapk12)
  09159 Environmental adaptation
   04714 Thermogenesis
    60352 (Mapk12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    60352 (Mapk12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    60352 (Mapk12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    60352 (Mapk12)
   05161 Hepatitis B
    60352 (Mapk12)
   05171 Coronavirus disease - COVID-19
    60352 (Mapk12)
   05163 Human cytomegalovirus infection
    60352 (Mapk12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    60352 (Mapk12)
   05169 Epstein-Barr virus infection
    60352 (Mapk12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    60352 (Mapk12)
   05135 Yersinia infection
    60352 (Mapk12)
   05133 Pertussis
    60352 (Mapk12)
   05152 Tuberculosis
    60352 (Mapk12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    60352 (Mapk12)
   05140 Leishmaniasis
    60352 (Mapk12)
   05142 Chagas disease
    60352 (Mapk12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    60352 (Mapk12)
   05020 Prion disease
    60352 (Mapk12)
   05022 Pathways of neurodegeneration - multiple diseases
    60352 (Mapk12)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    60352 (Mapk12)
   05418 Fluid shear stress and atherosclerosis
    60352 (Mapk12)
   05415 Diabetic cardiomyopathy
    60352 (Mapk12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    60352 (Mapk12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    60352 (Mapk12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    60352 (Mapk12)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     60352 (Mapk12)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   60352 (Mapk12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Kdo Haspin_kinase Kinase-like UvrD_C
Other DBs
NCBI-GeneID: 60352
NCBI-ProteinID: NP_068514
RGD: 70975
Ensembl: ENSRNOG00000031233
UniProt: Q63538
Position
7
AA seq 367 aa
MSSPPPARKGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGNKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHETLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKILFKGNDHLDQLKEIMK
VTGTPPPEFVQKLQSAEAKNYMEGLPELEKKDFASVLTNASPQAVNLLEKMLVLDAEQRV
TAAEALAHPYFESLRDTEDEPKAQKYDDSFDDVDRTLEEWKRVTYKEVLSFKPPRQLGAR
VPKETAL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagctccccgccacccgcccgcaagggcttttaccgccaggaggtgaccaaaacggcc
tgggaggtgcgcgccgtgtaccaggacctgcagcccgttggctctggtgcctatggtgca
gtgtgctctgcagtagacagccgcactggcaacaaggtggccatcaagaagttgtaccgg
cccttccagtcggagctgtttgccaagcgcgcctacagagagttgcgcctcctcaaacac
atgcgccacgagaacgtcattgggctgctggatgtgttcactcccgatgagactctggat
gacttcacagacttctacctggtgatgccattcatgggcactgacctgggcaagctcatg
aagcacgagactctgagtgaagacagaatccagtttcttgtgtatcagatgctgaagggg
ctgaagtatatccacgctgccggcgtcatccacagggacttgaaacctggaaacctggct
gtgaacgaggactgtgagctgaagatcctagattttggccttgccaggcaggcggacagt
gagatgacaggatatgtggtaacccggtggtatcgggcaccagaggtcatcttgaattgg
atgcgttacacacagacagtggacatttggtctgttggctgcatcatggcagagatgatt
actggaaagatcctgttcaaaggcaatgaccacctggaccagctgaaggagatcatgaaa
gtcacagggacaccccctcctgagtttgtacagaagctacagagtgctgaggccaagaac
tacatggaaggcctccctgagttggaaaagaaggattttgcttctgtcctgaccaatgca
agccctcaggccgtgaatctcctggaaaagatgctggtgttggatgcggaacagcgggtg
acagcagctgaggcattagcccacccatactttgagtcccttcgggacactgaggatgag
cccaaggcccagaaatatgatgactcctttgatgacgtagaccgcacccttgaggaatgg
aagcgtgttacgtataaggaagtgctcagcttcaagcctcccaggcagctaggagccaga
gttccaaaggagacagctctgtga

KEGG   Rattus norvegicus (rat): 689314
Entry
689314            CDS       T01003                                 

Gene name
Mapk11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04015  Rap1 signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04714  Thermogenesis
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05205  Proteoglycans in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    689314 (Mapk11)
   04015 Rap1 signaling pathway
    689314 (Mapk11)
   04370 VEGF signaling pathway
    689314 (Mapk11)
   04668 TNF signaling pathway
    689314 (Mapk11)
   04068 FoxO signaling pathway
    689314 (Mapk11)
   04071 Sphingolipid signaling pathway
    689314 (Mapk11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    689314 (Mapk11)
   04218 Cellular senescence
    689314 (Mapk11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    689314 (Mapk11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    689314 (Mapk11)
   04613 Neutrophil extracellular trap formation
    689314 (Mapk11)
   04620 Toll-like receptor signaling pathway
    689314 (Mapk11)
   04621 NOD-like receptor signaling pathway
    689314 (Mapk11)
   04622 RIG-I-like receptor signaling pathway
    689314 (Mapk11)
   04625 C-type lectin receptor signaling pathway
    689314 (Mapk11)
   04660 T cell receptor signaling pathway
    689314 (Mapk11)
   04658 Th1 and Th2 cell differentiation
    689314 (Mapk11)
   04659 Th17 cell differentiation
    689314 (Mapk11)
   04657 IL-17 signaling pathway
    689314 (Mapk11)
   04664 Fc epsilon RI signaling pathway
    689314 (Mapk11)
   04670 Leukocyte transendothelial migration
    689314 (Mapk11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    689314 (Mapk11)
   04914 Progesterone-mediated oocyte maturation
    689314 (Mapk11)
   04917 Prolactin signaling pathway
    689314 (Mapk11)
   04926 Relaxin signaling pathway
    689314 (Mapk11)
   04935 Growth hormone synthesis, secretion and action
    689314 (Mapk11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    689314 (Mapk11)
  09156 Nervous system
   04728 Dopaminergic synapse
    689314 (Mapk11)
   04723 Retrograde endocannabinoid signaling
    689314 (Mapk11)
   04722 Neurotrophin signaling pathway
    689314 (Mapk11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    689314 (Mapk11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    689314 (Mapk11)
  09159 Environmental adaptation
   04714 Thermogenesis
    689314 (Mapk11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    689314 (Mapk11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    689314 (Mapk11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    689314 (Mapk11)
   05161 Hepatitis B
    689314 (Mapk11)
   05171 Coronavirus disease - COVID-19
    689314 (Mapk11)
   05163 Human cytomegalovirus infection
    689314 (Mapk11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    689314 (Mapk11)
   05169 Epstein-Barr virus infection
    689314 (Mapk11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    689314 (Mapk11)
   05135 Yersinia infection
    689314 (Mapk11)
   05133 Pertussis
    689314 (Mapk11)
   05152 Tuberculosis
    689314 (Mapk11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    689314 (Mapk11)
   05140 Leishmaniasis
    689314 (Mapk11)
   05142 Chagas disease
    689314 (Mapk11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    689314 (Mapk11)
   05020 Prion disease
    689314 (Mapk11)
   05022 Pathways of neurodegeneration - multiple diseases
    689314 (Mapk11)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    689314 (Mapk11)
   05418 Fluid shear stress and atherosclerosis
    689314 (Mapk11)
   05415 Diabetic cardiomyopathy
    689314 (Mapk11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    689314 (Mapk11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    689314 (Mapk11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    689314 (Mapk11)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     689314 (Mapk11)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   689314 (Mapk11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 689314
NCBI-ProteinID: NP_001103002
RGD: 1309340
Ensembl: ENSRNOG00000006984
UniProt: A0A0G2KB06
Position
7
AA seq 364 aa
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSVFHGANPLAVDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPDDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPLETSQLPGTH
EIEQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcgggtccgcgcgcgggattctaccggcaagagctgaacaaaacagtatgggaggtg
ccgcagcggctgcagggcctacgcccggtgggctccggcgcctacggctcggtctgttcg
gcctacgacgcacggctgcgccagaaggtggctgtgaagaagctgtctcgccctttccaa
tcgctgatccacgcgaggaggacataccgtgagctacgcctactcaaacacctgaagcac
gagaacgtcataggacttttggacgtcttcacgccggccacatccatcgaggatttcagc
gaagtgtacctcgtgaccaccctgatgggcgctgacctgaataacatcgtcaagtgtcag
gccctgagcgatgagcatgttcagttccttgtctaccagctgctgcgtgggctgaagtat
atccactcggcgggcatcatccaccgggacctgaagcccagcaatgtagcagtgaatgag
gactgcgagctgaggatcctggactttgggctggcacgccaggctgatgaggagatgact
ggatatgtggccacacggtggtaccgggctccagagatcatgctgaactggatgcactac
aaccagacagtggacatctggtctgtgggctgcatcatggctgagctgctccaaggaaag
gccctctttcctggaaatgactacatcgaccagctgaagcggatcatggaggtggtgggc
acacccagccctgaggttctggcaaagatatcctcggagcatgcccggacatacatccag
tctctgcctcccatgccccagaaggacctcagcagtgtcttccatggggccaaccctctg
gctgtagacctccttggaagaatgctggtgctagacagtgaccagagagtcagtgcggcc
gaagccttggcccatgcatacttcagccagtaccatgaccctgacgacgagccagaggcc
gagccctatgatgaaagtgttgaggccaaggagcgcaccctggaggagtggaaggagctt
acttaccaggaagtccttagcttcaagcccctggaaacatcgcagctccctggcacccat
gaaattgagcagtga

KEGG   Rattus norvegicus (rat): 81649
Entry
81649             CDS       T01003                                 

Gene name
Mapk14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04015  Rap1 signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04714  Thermogenesis
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05205  Proteoglycans in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    81649 (Mapk14)
   04015 Rap1 signaling pathway
    81649 (Mapk14)
   04370 VEGF signaling pathway
    81649 (Mapk14)
   04668 TNF signaling pathway
    81649 (Mapk14)
   04068 FoxO signaling pathway
    81649 (Mapk14)
   04071 Sphingolipid signaling pathway
    81649 (Mapk14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    81649 (Mapk14)
   04218 Cellular senescence
    81649 (Mapk14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    81649 (Mapk14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    81649 (Mapk14)
   04613 Neutrophil extracellular trap formation
    81649 (Mapk14)
   04620 Toll-like receptor signaling pathway
    81649 (Mapk14)
   04621 NOD-like receptor signaling pathway
    81649 (Mapk14)
   04622 RIG-I-like receptor signaling pathway
    81649 (Mapk14)
   04625 C-type lectin receptor signaling pathway
    81649 (Mapk14)
   04660 T cell receptor signaling pathway
    81649 (Mapk14)
   04658 Th1 and Th2 cell differentiation
    81649 (Mapk14)
   04659 Th17 cell differentiation
    81649 (Mapk14)
   04657 IL-17 signaling pathway
    81649 (Mapk14)
   04664 Fc epsilon RI signaling pathway
    81649 (Mapk14)
   04670 Leukocyte transendothelial migration
    81649 (Mapk14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    81649 (Mapk14)
   04914 Progesterone-mediated oocyte maturation
    81649 (Mapk14)
   04917 Prolactin signaling pathway
    81649 (Mapk14)
   04926 Relaxin signaling pathway
    81649 (Mapk14)
   04935 Growth hormone synthesis, secretion and action
    81649 (Mapk14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    81649 (Mapk14)
  09156 Nervous system
   04728 Dopaminergic synapse
    81649 (Mapk14)
   04723 Retrograde endocannabinoid signaling
    81649 (Mapk14)
   04722 Neurotrophin signaling pathway
    81649 (Mapk14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    81649 (Mapk14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    81649 (Mapk14)
  09159 Environmental adaptation
   04714 Thermogenesis
    81649 (Mapk14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    81649 (Mapk14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    81649 (Mapk14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    81649 (Mapk14)
   05161 Hepatitis B
    81649 (Mapk14)
   05171 Coronavirus disease - COVID-19
    81649 (Mapk14)
   05163 Human cytomegalovirus infection
    81649 (Mapk14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    81649 (Mapk14)
   05169 Epstein-Barr virus infection
    81649 (Mapk14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    81649 (Mapk14)
   05135 Yersinia infection
    81649 (Mapk14)
   05133 Pertussis
    81649 (Mapk14)
   05152 Tuberculosis
    81649 (Mapk14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    81649 (Mapk14)
   05140 Leishmaniasis
    81649 (Mapk14)
   05142 Chagas disease
    81649 (Mapk14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    81649 (Mapk14)
   05020 Prion disease
    81649 (Mapk14)
   05022 Pathways of neurodegeneration - multiple diseases
    81649 (Mapk14)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    81649 (Mapk14)
   05418 Fluid shear stress and atherosclerosis
    81649 (Mapk14)
   05415 Diabetic cardiomyopathy
    81649 (Mapk14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    81649 (Mapk14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    81649 (Mapk14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    81649 (Mapk14)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     81649 (Mapk14)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   81649 (Mapk14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 81649
NCBI-ProteinID: NP_112282
RGD: 70496
Ensembl: ENSRNOG00000000513
Vega: OTTRNOG00000001971
UniProt: Q56A33
Position
20
AA seq 360 aa
MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtcgcaggagaggcccacgttctaccggcaggagctgaacaagaccgtctgggaggtg
cccgagcgataccagaacctgtccccggtgggctcgggagcctacggctcggtgtgtgct
gcttttgatacaaagacgggacatcgtgtggcagtgaagaagctgtcgagaccgtttcag
tccatcattcacgccaaaaggacctacagggagctgcggctgctgaagcacatgaagcac
gagaatgtgattggtctgttggatgtgtttacacctgcaaggtccctggaggaattcaac
gatgtgtacctggtgacccatctcatgggggcagacctgaacaacatcgtgaagtgtcag
aagcttaccgatgaccacgttcagtttcttatctaccagatcctgcgagggctgaagtat
atacactcggctgacataatccacagggacctaaagcccagcaacctcgctgtgaatgaa
gactgtgagctgaagattctggattttgggctggctcggcacactgatgacgaaatgacc
ggctacgtggctacccggtggtacagagcccccgagattatgctgaattggatgcactac
aaccagacagtggatatttggtccgtgggctgcatcatggctgagctgttgaccggaaga
acgttgtttcctggtacagaccatattaaccagcttcagcagataatgcgtctgacgggg
acaccccctgcttatctcattaacaggatgccaagccatgaggcaagaaactacattcag
tctctggcccagatgccgaagatgaacttcgcaaatgtatttattggtgccaatcccctg
gctgtcgacctgctggaaaagatgctggttttggactcggataagaggatcacagcagcc
caagctcttgcgcatgcctactttgctcagtaccacgaccctgatgatgagccagtggct
gacccttatgaccagtcctttgaaagcagggacctccttatagacgaatggaagagcctg
acctacgatgaagtcattagctttgtgccaccgccccttgaccaagaagaaatggagtcc
tga

DBGET integrated database retrieval system