KEGG   Rattus norvegicus (rat): 114512
Entry
114512            CDS       T01003                                 

Gene name
Aatf, Ded
Definition
(RefSeq) apoptosis antagonizing transcription factor
  KO
K14782  protein AATF/BFR2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    114512 (Aatf)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  90S particles
   Other 90S particles
    114512 (Aatf)
SSDB
Motif
Pfam: AATF-Che1 TRAUB Vif
Other DBs
NCBI-GeneID: 114512
NCBI-ProteinID: NP_446172
RGD: 620685
Ensembl: ENSRNOG00000002778
UniProt: Q9QYW0
Position
10q26
AA seq 523 aa
MAELQPLALQLEQLLNPRPREADPEADPEEATRARVIDRFDEGEEEEDDLPVSSIRKLAP
VSLLDTDKRYSGKTTSRKAWKEDHWDQTLPSSSDNEIPDEGGSEAGDSEGLEELSEDVEE
DLEDNEIPDEGGSEDGDSEGLEEEISEDVEEDLEGEDEEDREEDRNSEDDGVVMAFSGVK
VSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPVFKDKGGPEFASALK
NSHKALKALLRSLVDLQEELLFQYPDTRYLVKGTKPNAESEEISSEDDELVGEKKKQRKA
PPKRKLEMEDYPSFMAKRSADFTVYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQID
HILMDKERLLRRTQTKRSAYRVLGKPEPVPEPVAETLPGEPESLPQVPANAHLKDLDEEI
FDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQWLAIQKLRSKIRKKVDRKASKGRKLRF
HVLSKLLSFMAPIDHTAMNDEARTELYRSLFGQLNRLDADHGQ
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggcggagctgcagcccctggctctgcagctggaacagttgttgaatccaagaccgcgt
gaggcggatcctgaggcggacccggaggaggccactagagccagagtgattgacaggttt
gatgaaggggaagaggaagaagatgatctgccagtgagtagtattagaaagttggcaccg
gtctccctcttggacaccgacaaaaggtattctggcaagaccacttctcggaaagcttgg
aaagaagaccattgggaccagactctgccaagttcatcggacaatgaaatacctgatgaa
ggaggctctgaagctggggattcagagggcctggaggagctctcagaagatgttgaggaa
gacttggaagacaatgaaatacctgatgaaggaggctctgaagatggggattcagagggc
ctggaggaggagatctcagaagatgttgaggaagacttagaaggtgaggatgaggaagac
agagaagaggacaggaacagtgaagatgacggcgtggtgatggccttctccggtgttaaa
gtttctgaggaagtggaaaaaggaagagctgtgaagaaccagatagcgttgtgggaccag
ctcttggaaggaaggatcaaactacaaaaagctctcttgactaccaatcaattgcctcaa
ccagatgttttccctgtcttcaaggacaaaggtggcccagaatttgccagtgctctgaaa
aatagtcacaaagcacttaaagcattgttaagatcattggtggatcttcaggaagagttg
cttttccagtacccagatacaagatatttagtaaaagggacgaaacccaatgcagagagt
gaggagatttccagtgaagatgatgagctagtgggagagaagaagaaacaaagaaaggcc
ccaccaaagaggaagctagagatggaggactatcccagcttcatggcaaagcgctctgct
gactttaccgtctacaggaaccgcacactacaaaaatggcatgataaaaccaagcttgct
tctggaaaactgggcaagggtttcggtgcctttgaacgctccatcttgactcagattgat
catattctgatggacaaagaaagattacttcgaaggacgcagaccaagcgctctgcctac
cgagttcttggcaaacctgagccagtccctgagcctgttgcagagactttgccaggagaa
ccggagagccttcctcaggtccctgccaatgctcacctgaaggacttggacgaggagata
tttgatgatgatgacttctaccaccagctccttcgagaactcatagagcggaagaccagc
tctttggatccaaatgatcaggtggccatgggaaggcagtggcttgcaatccagaaacta
cgaagcaaaatccgcaagaaggtagatagaaaagccagcaaaggaagaaaacttcggttc
catgtgcttagcaagctcctgagtttcatggcgcctattgaccacactgcaatgaatgat
gaggccaggaccgagttgtatcgatctcttttcggccagctcaaccgtctggacgcagac
catgggcagtga

DBGET integrated database retrieval system