KEGG   Rattus norvegicus (rat): 114518
Entry
114518            CDS       T01003                                 

Gene name
Slc7a10, Asc-1
Definition
(RefSeq) solute carrier family 7 member 10
  KO
K13782  solute carrier family 7 (D/L-type amino acid transporter), member 10
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    114518 (Slc7a10)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   114518 (Slc7a10)
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-GeneID: 114518
NCBI-ProteinID: NP_446178
RGD: 621672
Ensembl: ENSRNOG00000010938
UniProt: Q75T81
Position
1q21
AA seq 530 aa
MRRDSDMTGHIQQPGGRGNPSPAPSPSPGPGPGPGASERVALKKEIGLVSACTIIIGNII
GSGIFISPKGVLEHSGSVGLALFVWVLGGGVTALGSLCYAELGVTIPKSGGDYAYVTEIF
GGLAGFLLLWSAVLIMYPTSLAVISMTFSNYVLQPVFPNCIPPATASRVLSMACLMLLTW
VNSSSVRWATRIQVIFTGGKLLALSLIITVGFVQIFQGHFEELRPTNAFTFWMTPSVGHL
ALAFLQGSFAFSGWNFLNYVTEELVDPRKNLPRAIFISIPLVTFVYTFTNVAYFTAMSPQ
ELLSSNAVAVTFGEKLLGYFSWVMPVSVALSTFGGINGYLFTSSRLCFSGAREGHLPSFL
AMIHVRRCTPIPALLVCCGATAVIMLVGDTYTLINYVSFINYLCYGVTILGLLVLRWRRP
ALHRPIKVNLLIPVVYLVFWAFLLVFSFISEPMVCGVGIIIILTGVPIFFLGVFWRSKPK
CVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITDKPLKTQ
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgaggcgggacagcgacatgacaggccatatacagcagccaggcgggcgcgggaacccc
agccctgcgccctcgccctccccgggccctggtcctggcccgggcgcctcggagcgggtg
gcactcaagaaagagatcgggctggtgagcgcctgcaccatcatcatcgggaacatcatt
ggctcgggtatcttcatctcaccgaagggcgtcctggaacactcgggctccgtgggtttg
gccctcttcgtctgggtcctgggtgggggcgtgacagctctaggctctctctgctatgca
gagctgggcgtcaccatccccaagtctggtggggactacgcctatgtcactgagatcttc
gggggcctggctggattcctgctgctctggagtgctgtcctcatcatgtaccccaccagc
ctggctgtcatctccatgacattctccaactatgtgcttcagcctgtctttcccaactgt
atccccccagccacagcctctcgagtactctccatggcctgcctgatgctcctgacatgg
gtgaacagctccagcgtacgctgggccacgcgcatccaggttatcttcactggcgggaag
ctgttggcgttgtctctcatcatcaccgtgggctttgtccagatcttccaaggacacttt
gaagagctgagacccaccaatgccttcaccttctggatgacaccgtctgtgggtcaccta
gccctggctttcctccaaggttcttttgccttcagtggttggaacttcctcaactatgtc
accgaggagctggttgaccctcgaaagaacctacctcgtgccatcttcatttccatccca
ctggtcacctttgtgtacacattcaccaatgttgcctacttcactgccatgtccccccag
gagctgctgtcctccaacgcagtggctgtgaccttcggcgagaagctgctgggctacttt
tcgtgggtcatgcctgtgtctgtggcgctgtctacttttggagggatcaatggctacctg
ttcacctcatccaggctatgtttctctggagcccgagagggacacttacccagctttctg
gccatgattcatgtcagacgctgtaccccaatccctgccctccttgtctgttgcggggcc
acagcggtcatcatgctcgtgggtgacacatacacactcatcaactatgtgtccttcatc
aactacctctgctacggagtcactatcctgggcctgcttgtgctgcgctggagacggccg
gcacttcacaggcccattaaggtgaacctcctcattcctgttgtgtacttggtgttctgg
gcattcctcctggtcttcagcttcatctcggagcccatggtctgtggggtcggcatcatc
attatcctcactggggtccccatcttcttcctgggagtgttctggagaagcaaaccaaag
tgtgtacacagattcacagagtccatgacacgctggggccaggagctgtgtttcgtggtt
tacccccagggctccctggaggaggaggaaaatggccccatgggccagccctccccattg
cccatcacggacaagcccttgaagacacaatga

DBGET integrated database retrieval system