KEGG   Rattus norvegicus (rat): 114521
Entry
114521            CDS       T01003                                 

Gene name
Tdg
Definition
(RefSeq) thymine-DNA glycosylase
  KO
K20813  thymine-DNA glycosylase [EC:3.2.2.29]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    114521 (Tdg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    114521 (Tdg)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.29  thymine-DNA glycosylase
     114521 (Tdg)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     114521 (Tdg)
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-GeneID: 114521
NCBI-ProteinID: NP_446181
RGD: 620959
Ensembl: ENSRNOG00000027124
Vega: OTTRNOG00000001133
UniProt: Q99NG8
Position
7q13
AA seq 386 aa
MMAEAPNMADVAGQQMPAEAPAQDPVPEAPKRRKRKTRAAEAQDPVEPKKPAASKKSGKS
TKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYK
GHHYPGPGNHFWKCLFMSGLSEVQLSHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEF
REGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYV
MPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERSTDVQEVQYTFDLQLAQEDAKRTA
VKEEKYDPGYEAAYGGACGENPCNGEPCGFASNGLTANSAELGGESAPSDVPNGQWMAQS
FAEQIPSFNNCGTGEQEAGSHAGSHA
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgatggcggaggctccgaacatggcagacgtggccggacagcagatgcctgcagaagct
cctgcccaggatcctgtgccagaggctccaaagagaaggaaaaggaaaaccagggcagca
gaggcccaggacccagtggagcccaaaaagcctgctgcctcaaagaaatctggcaagtcc
acaaaatcaaaagaaaagcaagagaaaatcacagacacctttaaagtgaaaaggaaagtg
gaccggttcaacggtgtctctgaagctgagcttctgaccaagactctccctgacattttg
accttcaatctggatattgtaattattggcatcaacccaggattaatggccgcttacaaa
gggcatcattaccctgggcccggaaatcacttctggaaatgtctgttcatgtctgggttg
agcgaggtgcagctgagtcacatggatgaccacaccttacctggaaaatacggcatcgga
ttcaccaacatggtggaacggacaacgccaggcagcaaggatctgtctagtaaagaattc
cgggaaggagggcgtatcctagtgcagaaactacagaaatatcagccacgaatagcggtg
tttaatggaaaatgtatttatgagattttcagtaaagaagtttttggagtaaaggttaag
aacttggaatttgggcttcaaccgcacaagatcccagacacagaaactctctgctacgtc
atgccgtcctccagtgcccggtgcgctcagttccctcgggcgcaggacaaagtccattac
tacattaagctgaaggacttgcgagaccagctgaagggcatcgagcgcagcacggacgtt
caggaggtgcagtacacgttcgacctgcagctcgcacaagaggacgcaaagaggacggct
gttaaggaagaaaagtatgacccaggctatgaggcagcgtatggcggtgcctgtggtgaa
aacccgtgtaatggggaaccttgtggctttgcttcaaatgggctaacagccaacagtgcg
gagctgggaggagaatcagctccgagcgacgttccaaacgggcagtggatggcgcagtcg
tttgcagagcagatcccttctttcaataattgtggcacaggagagcaggaagcaggaagc
catgcaggaagccatgcttag

DBGET integrated database retrieval system