KEGG   Rattus norvegicus (rat): 114552Help
Entry
114552            CDS       T01003                                 

Gene name
Bcl2l10
Definition
(RefSeq) BCL2 like 10
  KO
K18451  Bcl-2-like protein 10
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    114552 (Bcl2l10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2
Motif
Other DBs
NCBI-GeneID: 114552
NCBI-ProteinID: NP_446185
RGD: 621015
Ensembl: ENSRNOG00000009308
UniProt: Q99M66
Position
8q24
AA seq 185 aa AA seqDB search
MGDPLQDRTRRLLTDYILFCARAPNTPEPLPTSVEAALLRSVTSQIQQEHQDLFNSFRDY
QGNRLELVTQMADELLSNDQEFNWGRLVMLLAFVGTLMNQDRTVKRRRDQRNRLLLERDC
YLIVSLLYNRLTGRHRSWLEAHGGWDGFCQFFKNPLPPGFWRRLLIRAILSCFFATAIFY
IWKCL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacccgctgcaggatcgcactagacggctgctgactgactacatattgttctgc
gcacgggcgccgaacacccctgagccactgcccacgtctgttgaggcggccttgctgcgc
tctgtgactagtcagatccaacaggagcaccaggatcttttcaactccttccgcgactac
cagggcaaccgcctggagctggtgacacagatggcggatgagttgctctccaatgaccaa
gagttcaactggggccgcctggtgatgctcctggccttcgtggggacgctaatgaaccaa
gacaggactgttaagcggaggagggatcaaagaaaccgtctcctactggagcgagactgc
tatctcatagtgagcttgctgtacaatcgactcacaggacggcatcgctcctggctggag
gctcacggtggctgggatggcttttgccaattcttcaagaaccccttaccacccggcttc
tggagaagattgctgatccgggctattctgtcctgtttctttgcaacggccatcttttat
atctggaaatgtttataa

DBGET integrated database retrieval system