KEGG   Rattus norvegicus (rat): 114554
Entry
114554            CDS       T01003                                 

Gene name
Pi4k2a
Definition
(RefSeq) phosphatidylinositol 4-kinase type 2-alpha
  KO
K13711  phosphatidylinositol 4-kinase type 2 [EC:2.7.1.67]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    114554 (Pi4k2a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    114554 (Pi4k2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    114554 (Pi4k2a)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.67  1-phosphatidylinositol 4-kinase
     114554 (Pi4k2a)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    114554 (Pi4k2a)
SSDB
Motif
Pfam: PI3_PI4_kinase Ribosomal_S15
Other DBs
NCBI-GeneID: 114554
NCBI-ProteinID: NP_446187
RGD: 620485
Ensembl: ENSRNOG00000014675
UniProt: Q99M64
Position
1
AA seq 478 aa
MDETSPLVSPERAQPPEYTFPSVSGAHFPQVPGGAVRVAAAGSGPSPPCSPGHDRERQPL
LDRARGAAAQGQTHTVAAQAQALAAQAAVAVHAVQTHRERNDFPEDPEFEVVVRQAEIAI
ECSIYPERIYQGSSGSYFVKDSQGRIIAVFKPKNEEPYGNLNPKWTKWLQKLCCPCCFGR
DCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKV
PKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVLD
YIIRNTDRGNDNWLIKYDYPMDNPNCRDTDWVMVREPVIKVAAIDNGLAFPLKHPDSWRA
YPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIA
VMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggacgagacgagcccgctagtgtcccccgagcgggcccaaccccctgagtacaccttc
ccgtcggtctcgggagctcactttccgcaggtaccggggggcgcggtccgcgtagcggcg
gccggctccggcccgtccccgccgtgctctccgggccacgaccgggagcggcagcccctg
ctggaccgggcccggggcgcggcggcgcagggtcagacccacacggtggcggcgcaggcc
caggccctggccgcccaggcggccgtggcggtgcacgccgttcagacccaccgcgagcga
aacgacttcccggaggaccccgagttcgaggtggtggtgcggcaggccgagatagccatc
gagtgcagcatctatcccgagcgcatctaccagggctccagtggaagctacttcgtcaag
gactctcaggggaggatcattgctgtcttcaaacccaagaatgaagagccatacgggaac
cttaaccctaagtggaccaaatggcttcagaagctgtgctgcccctgctgctttggccga
gattgccttgttctcaaccagggctatctctcagaagcaggggctagcctggtggaccaa
aaactggaactcaacattgtaccccgtacaaaggtagtatacctggccagtgaaaccttc
aactatagtgccattgaccgagtaaagtccaggggcaagcgacttgcactagagaaagtg
ccaaaagttgggcagcggtttaaccgcattgggctaccaccaaaggtcgggtcattccag
ctctttgttgaaggctacaaagatgcagactattggctacggcgttttgaagcagaacct
cttcccgagaacacgaaccgacagctactattgcagtttgagcggttggtggtcctggac
tacatcatccgcaacactgaccgaggcaatgacaactggttgatcaaatatgactatccg
atggataatcctaactgtcgggacacagactgggtgatggtgagggagcctgttatcaag
gtggccgccatagacaatggactggctttcccactgaagcaccctgactcctggagggca
tatcctttttactgggcctggttgccacaggcgaaagtcccattctctcaggagatcaaa
gatttgattcttccaaagatttcagaccctaacttcgtcaaggacttggaggaggaccta
tatgaactcttcaagaaagatcctggtttcgacaggggccagttccataagcagattgct
gtcatgagaggtcagatcctaaatttgacccaggccctaaaagacaataagagtcccctg
cacctcgtccagatgccacccgtgattgttgagacggcccgttctcatcagcggtcttca
agtgaatcctacacacagagcttccagagtcggaagcccttcttttcatggtggtag

KEGG   Rattus norvegicus (rat): 305419
Entry
305419            CDS       T01003                                 

Gene name
Pi4k2b
Definition
(RefSeq) phosphatidylinositol 4-kinase type 2-beta
  KO
K13711  phosphatidylinositol 4-kinase type 2 [EC:2.7.1.67]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    305419 (Pi4k2b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    305419 (Pi4k2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    305419 (Pi4k2b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.67  1-phosphatidylinositol 4-kinase
     305419 (Pi4k2b)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    305419 (Pi4k2b)
SSDB
Motif
Pfam: PI3_PI4_kinase
Other DBs
NCBI-GeneID: 305419
NCBI-ProteinID: NP_001005883
RGD: 1359515
Ensembl: ENSRNOG00000003924
UniProt: Q5XIL2
Position
14
AA seq 477 aa
MPEPPRDIMAEACEATRPSEDEDEEREPLLPRVAWAQPRRGAPGSAVRLQADQGAAVLRE
PATEEPPVVSEDRSISASLSTELDRTRNAVSETNTFLEDPEFADVVLKAEQAIEIGVFPE
RISQGSSGSYFVKDSKRTIIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLLPNQ
GYLSEAGAYLVDTKLQLGIVPKTKVVWLVSETFNYSAIDRAKSRGKKYALEKVPKVGRKF
HRIGLPPKIGSFQLFVKDYKEAEYWLRRFEAEPLPENIRKQFQSQFERLVILDYIIRNTD
RGNDNWLVKYDEMKYAKKIESEESNWIDDKQLLIRIAAIDNGLAFPFKHPDEWRAYPFHW
AWLPQAKVPFSEETRNLILPFISDMNFVQDLCEDLYELFKTDKGFDRAAFESQMSVMRGQ
ILNLTQALRDGKSPMQLAQMPCVIVECSKSGGQGRVVHLGSSFTQTVHCRKPFFSSW
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgcccgagccgccccgggacatcatggcggaggcctgcgaggccacccgcccctcggag
gatgaggacgaggagcgggagccgctgctgcctcgtgtcgcttgggcccagccgcggagg
ggcgcgcccgggagcgccgtaaggctgcaggcggaccagggcgcggctgtccttcgcgag
cccgccaccgaagagccgccggtggtgtccgaggaccggtcgatctccgcgagcttgtcc
accgagctggaccggacccgcaacgcagtctcagaaacaaacacattcttggaagatcca
gaatttgctgatgttgtactgaaagcagagcaagcgatagaaattggagttttcccagag
aggatctctcaagggtcaagtggaagttattttgtgaaggattctaaaaggactataatt
ggtgtgtttaaacccaaatcagaagagccttatggtcagctgaaccccaagtggaccaag
tatgtccacaaggtttgctgtccctgctgtttcggccgaggctgcctgcttcctaaccag
ggctacctttctgaagccggtgcctacctggtggataccaagcttcagctgggcattgta
cctaaaacaaaggtggtttggcttgtcagtgagacatttaactacagtgcgattgaccgt
gcaaaatcaagaggcaaaaagtatgccttagagaaagtaccaaaagtaggtagaaagttc
catcggataggacttcctcctaagattggttcctttcagctgtttgtgaaagattacaag
gaggctgaatattggcttaggaggtttgaagccgagcctttgcccgagaacattagaaaa
caatttcagtcacagtttgaaagattagtgattctggattacatcatcagaaacacagac
aggggaaatgataattggctagtcaaatatgacgagatgaaatatgcaaagaaaattgaa
agtgaggaatcaaactggatcgatgataaacaattgcttattagaatagctgcaattgac
aatgggctagcatttcccttcaagcatcctgatgaatggagagcatatccatttcactgg
gcttggctccctcaagcaaaagttcctttctctgaagaaactcgaaacttgattctaccc
tttatttctgacatgaactttgtccaagacttgtgtgaagatctttatgaactttttaag
actgacaaaggatttgacagagctgcttttgaaagtcagatgtctgtgatgagaggccag
atcttaaacctcactcaggcgctgagagatggcaagagtcctatgcagctggcacagatg
ccatgcgtgatcgtggagtgcagcaaaagtggtggccaggggcgtgttgtacacctgggc
agctcctttacccagacggtccactgcaggaagccgttcttttcctcctggtag

DBGET integrated database retrieval system