KEGG   Rattus norvegicus (rat): 114555Help
Entry
114555            CDS       T01003                                 

Gene name
Casp4, Casp11
Definition
(RefSeq) caspase 4
  KO
K04394  caspase 4 [EC:3.4.22.57 3.4.22.64]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114555 (Casp4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    114555 (Casp4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.57  caspase-4
     114555 (Casp4)
    3.4.22.64  caspase-11
     114555 (Casp4)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C14: caspase family
   114555 (Casp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD DUF713
Motif
Other DBs
NCBI-GeneID: 114555
NCBI-ProteinID: NP_446188
RGD: 621757
Ensembl: ENSRNOG00000033697
UniProt: Q3MHS1
Position
8q11
AA seq 373 aa AA seqDB search
MAENNHPDKPLKVLEELGKEFLTEYLEKLVQSNVLKLKEEEKQKFNNAERSDKRWVFVDV
LKRKHNQVGKMLLQTFLNVDSGSHHGEANLEMEEPEESVDTLKLCSSEEFTRLCREKKQE
IYPIKETNGRTRKALIICNTEFKHLSLRYGANIDISGMKGLLEELGYDVVVKEELTAEGM
ESEMKDFAALSEHQTSDSTFLVLMSHGTLQGLCGTMHSEATPDVLLYDTIYQIFNNCHCP
GLRDKPKVIIVQACRGGNPGEVWIRESSGAHSYRAVDLPRNMEADAVRMSHVEKDFIALY
STTPHHLSYRDKTRGSYFISKLISCFRIHACSCHLFDIFLKVQQSFEKASINSQMPTIDR
ATLTRYFYLFPGN
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaacaaccaccctgataaaccacttaaggtgttggaagaactgggcaaagag
ttccttacagagtacctagaaaaattggtacaaagcaatgtattgaaattaaaggaagaa
gagaaacaaaaatttaacaatgctgaacgcagtgacaagcgctgggtttttgtagatgtc
ctgaaaaggaaacacaaccaagtgggcaaaatgcttctccagacatttcttaatgtggac
tcaggcagccaccatggtgaagctaatttggaaatggaggaaccagaagaatcagtggac
actctcaagctttgttcctccgaggagttcacaaggctgtgcagagaaaagaagcaagaa
atttacccaataaaggagaccaatggccgtactcgaaaggctcttatcatatgcaataca
gagttcaaacatctctccctgagatatggggctaacattgacattagtggcatgaaaggc
cttcttgaagagttgggctatgatgtggtggtgaaagaggagcttacggctgagggcatg
gaatcagaaatgaaagactttgctgcactctcagagcaccaaacatcagacagcacattc
ctggtgttaatgtctcatggcacattgcagggcctttgtggaacaatgcacagtgaagca
actccagatgtgctattatatgatactatctatcagatatttaacaattgtcactgtcca
ggtctacgagacaaacccaaagtcatcattgtgcaggcctgcagaggtggaaaccctggg
gaagtgtggatcagagagtcttcaggagcccactcctacagagctgtagatctacctagg
aatatggaagctgatgctgtccgcatgagccatgtggagaaggacttcattgccctctac
tctacaacaccacaccacttgtcctacagagacaaaacaagaggctcttacttcatctcc
aaactcatttcctgcttccggatacatgcctgctcttgtcatctatttgatatatttctg
aaggtgcaacaatcatttgaaaaggcaagtattaattcccagatgcccaccattgatcgg
gcaaccttgacaagatatttctacctctttcctggcaattga

DBGET integrated database retrieval system