KEGG   Rattus norvegicus (rat): 114558
Entry
114558            CDS       T01003                                 

Gene name
Becn1
Definition
(RefSeq) beclin-1
  KO
K08334  beclin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04136  Autophagy - other
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04215  Apoptosis - multiple species
rno04371  Apelin signaling pathway
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
rno05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    114558 (Becn1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114558 (Becn1)
   04136 Autophagy - other
    114558 (Becn1)
   04137 Mitophagy - animal
    114558 (Becn1)
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    114558 (Becn1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    114558 (Becn1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114558 (Becn1)
   05014 Amyotrophic lateral sclerosis
    114558 (Becn1)
   05016 Huntington disease
    114558 (Becn1)
   05017 Spinocerebellar ataxia
    114558 (Becn1)
   05022 Pathways of neurodegeneration - multiple diseases
    114558 (Becn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    114558 (Becn1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    114558 (Becn1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    114558 (Becn1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    114558 (Becn1)
SSDB
Motif
Pfam: APG6 APG6_N BH3 MT HAUS-augmin3 Exonuc_VII_L V_ATPase_I GAS NAPRTase_C
Other DBs
NCBI-GeneID: 114558
NCBI-ProteinID: NP_001029289
RGD: 620190
Ensembl: ENSRNOG00000020513
Vega: OTTRNOG00000000809
UniProt: Q91XJ1
Structure
PDB: 
3Q8T

Position
10
AA seq 448 aa
MEGSKASSSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGESQEEE
ANSGEEPFIETRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDL
FDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEMLEQMNEGDSEQLQR
ELKELALEEERLIQELEDVEKNRKVVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLE
LDDELKSVENQMRYAQMQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSAPVEWNE
INAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWD
NKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSE
EQWTKALKFMLTNLKWGLAWVSSQFYNK
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggaggggtctaaggcgtccagcagcaccatgcaggtgagcttcgtgtgccagcgctgt
agccagcctctgaaactggacacgagcttcaagatcctggaccgagtgaccattcaggaa
ctcacagctccattacttaccacagcccaggcgaaaccaggagagagccaggaggaagag
gctaactcaggagaggagccatttattgaaactcgccaggatggtgtctctcgaagattc
atccccccagccaggatgatgtctacagaaagtgctaatagcttcactctgatcggggag
gcatctgatggtggcaccatggagaacctcagccggagactcaaggtcactggagacctt
tttgacatcatgtctggccagacagatgtggatcacccactgtgtgaggaatgcacagat
actcttttagaccagctggacactcagctcaatgttactgaaaacgagtgtcagaactac
aaacgctgtttggagatgttggagcaaatgaatgagggcgacagtgaacagctacagagg
gagctgaaggagttggccttggaggaggagaggctgatccaggagctggaagatgtggaa
aaaaaccgaaaggtggtggcagaaaacctggagaaggtccaggctgaggcggagagactg
gaccaggaggaagctcagtaccagcgagaatatagtgaatttaaaaggcagcagctggag
ctggatgatgagctcaagagtgtagagaaccagatgcgctatgcccagatgcagctggac
aagctcaagaaaaccaatgtcttcaatgcgaccttccatatctggcacagcggacaattt
ggcacgatcaataatttcagactgggtcgcttgcccagtgctcctgtggaatggaatgaa
atcaatgctgcctggggccagacagtgttgttgctccatgctttggccaataagatgggt
ctgaaatttcagaggtaccgacttgttccctatggaaatcactcgtatctggagtccctg
acagacaaatctaaggagttgccgttgtactgttctgggggtttgcggtttttctgggac
aacaagtttgaccatgcaatggtagcttttctggactgtgtgcagcagttcaaagaagag
gtggaaaaaggagagactcgattttgtcttccgtacaggatggacgtggagaaaggcaag
attgaagacactggaggcagtggcggctcctattccatcaaaacccagtttaactctgag
gagcagtggacaaaggcgctcaagttcatgctgacgaatctcaagtggggtcttgcttgg
gtgtcctcacagttctataacaagtga

DBGET integrated database retrieval system