KEGG   Rattus norvegicus (rat): 114590
Entry
114590            CDS       T01003                                 

Gene name
Ubqln1
Definition
(RefSeq) ubiquilin-1
  KO
K04523  ubiquilin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114590 (Ubqln1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    114590 (Ubqln1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    114590 (Ubqln1)
   03051 Proteasome [BR:rno03051]
    114590 (Ubqln1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    114590 (Ubqln1)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    114590 (Ubqln1)
SSDB
Motif
Pfam: ubiquitin STI1 UBA Rad60-SLD Rad60-SLD_2 YukD Ubiquitin_5 DUF2407 CUE
Other DBs
NCBI-GeneID: 114590
NCBI-ProteinID: NP_446199
RGD: 620745
Ensembl: ENSRNOG00000019282
UniProt: Q9JJP9 A0A140TAI1
Position
17
AA seq 582 aa
MAESAESGGPPGAQDSAADSGPAEPKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRF
KSHIDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDNSAQQTNTTGNSVTS
SPAPDSNPTSGPAANSSFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLLSNPEMMVQI
MENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLELARNPAMMQ
EMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASLVSSPSSAEGT
QPSRTENRDPLPNPWAPQTPQSSPASGSTGSTTNTVSTSAGNATSTPAGQGTSGPNLVPG
AGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMMLNNPLFAG
NPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGLIPGFTP
GLAAGNSGGPAGTTAPSTAPGEDTNPQGGAAEPGHQQFIQQMLQALAGVNPQLQSPEVRF
QQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQPS
NT seq 1749 nt   +upstreamnt  +downstreamnt
atggccgagagcgcagagagcggcggcccaccgggcgctcaggacagtgcggccgacagc
ggccccgcagagcccaagatcatgaaggtcacggtgaagacgcctaaagagaaggaagag
ttcgctgtgcccgagaacagctcggtccagcagttcaaagaggaaatctcaaaacgtttc
aaatctcatattgaccaacttgtgttgatatttgctggaaaaattttaaaagatcaagat
actttgagtcagcatgggattcatgatggacttacggttcaccttgtcatcaaaacccaa
aacaggccgcaagataattcagctcagcaaacaaataccactggaaacagtgtgaccagt
tcaccagctcctgacagtaaccccacgtctgggcctgctgctaacagctcctttggttta
ggtggacttggaggacttgcaggtcttagtagcttgggtttaaataccaccaacttctct
gaactacagagccaaatgcagcggcaacttttgtctaaccctgaaatgatggtccagatc
atggaaaacccctttgtgcagagcatgctctcaaaccctgacctgatgcggcagctgatc
atggccaacccacagatgcagcagctgatacagagaaacccagagatcagtcacatgctc
aataacccagacataatgcgacagacattggaacttgccagaaacccagcgatgatgcag
gaaatgatgagaaaccaggaccgagccttgagcaacctagaaagtatccctgggggctac
aacgccttacggcgcatgtacacagatattcaggagcccatgctaaacgctgcgcaagag
cagtttggtggtaatccatttgcttccttagtgagcagtccgtcctcagcagaagggact
cagccttctcgaacagaaaatagggatccgctacctaacccttgggctccacagactccc
cagagctctccagcctctggcagcactggcagcaccactaacacagtgagcacctctgct
ggcaatgccaccagtaccccggcgggacagggcacctcagggcccaacttggtgcctgga
gcaggagctagtatgttcaacacgccagggatgcaaagcttgttgcagcaaataactgag
aaccctcagctcatgcagaacatgctgtctgccccctacatgagaagcatgatgcagtca
ctgagccagaaccccgaccttgccgcacagatgatgctgaataaccccctatttgctggg
aaccctcagcttcaagagcaaatgagacaacagctcccaaccttcctccaacaaatgcag
aaccccgacacactgtcagccatgtcgaaccctagagccatgcaggcgctgctgcaaatc
cagcagggcttgcagacgttggccacagaagctcccggcctcatcccagggtttactcct
ggcttggcagcgggcaattctggaggccctgcaggaaccactgcacctagcactgcacct
ggtgaggatacgaacccccaagggggcgctgctgagccaggccaccagcagtttatccag
caaatgctgcaggccctcgccggggtgaaccctcagctgcagagtccagaagtcagattt
caacagcaactggaacagctcagtgcaatgggattcttgaaccgtgaagcaaacttacaa
gcactgatagcaacagggggcgacatcaatgcggccattgaaaggttgctgggttcccag
ccgtcatag

KEGG   Rattus norvegicus (rat): 308905
Entry
308905            CDS       T01003                                 

Gene name
Ubqln3
Definition
(RefSeq) ubiquilin-3
  KO
K04523  ubiquilin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    308905 (Ubqln3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    308905 (Ubqln3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    308905 (Ubqln3)
   03051 Proteasome [BR:rno03051]
    308905 (Ubqln3)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    308905 (Ubqln3)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    308905 (Ubqln3)
SSDB
Motif
Pfam: ubiquitin STI1 UBA Rad60-SLD Rad60-SLD_2 YukD DUF2407 Ubiquitin_5 DUF6365
Other DBs
NCBI-GeneID: 308905
NCBI-ProteinID: NP_001101013
RGD: 1304920
Ensembl: ENSRNOG00000023833
UniProt: B1WBT8
Position
1
AA seq 655 aa
MAKSGEALPQGSPAPVQDSQLIRVTVKTPKDKEDFSVVDTCTIRQLKEKISHRFKAHPNQ
LVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKMQRRTTGTECPAPPVSTPGPNPLELPQP
NSAYPVDGSPSFSLGVLTGLSGLGLTSGSFSDQPGSLMWQHMSVPELVAQLVDDPFIQGL
LSNTGLMRQLVLDNPHMQQLIQQNPEIGHILNNPEIMRQTMEFLRNPSMMQEMMRSQDRA
LSNLESIPGGYNVLRTMYTDIMDPMLNAVQEQFGGNPFATATTASTTTTSSQPSRTENCD
PLPNPWTSTCGVSGSRQGRQPGDQDTSESRNRLPSFLGNIGLFDYLQQLHETSQALGSYL
QGTVPTPSSSQETPLSGNRVPPNLPPSPKPGSGQPLPKDSVAIKGKSSCPAFLRHSSENS
TGQGGSLHDSGKSSTGPSTGLPNLTSQIGDNANRSPFVSTPSSLISPTPGAPESPWLPPT
GYPRSLRSALTNQVPRMQNELHQQLPLLLHLQTAMTNPRVMQALLQIEQGLQILATEAPR
LLLWFMPCLAGLSGVIGGTESREGVVMSEDPRPTPTSQISLVQGSAELGFHSSPFLQVLQ
ALASTNPQQLQLEAHFRVQLEQLRAMGFLNLEANLQALIATGGDVDAAVEKLRKS
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggccaaaagtggagaggctctaccacagggcagcccagcgccagtacaggattcccag
ctcatccgggtgacagtgaagacacccaaggacaaggaggatttctcagttgtagacacg
tgtaccatccggcagttaaaggaaaagatatcacaccgctttaaggcacatccaaatcag
ctggtcctgatctttgcgggaaaaatcctcaaggaccctgactcattggcacagtgtgga
gttcgagatggcctcacagttcacctcgtcatcaagatgcagcgtcggaccacaggcact
gagtgcccagcaccaccagtctccactccaggcccaaatcctctagaactccctcagcca
aattctgcttaccctgtggatgggtctccttctttcagcttaggggtcctcacaggcctc
agtgggttgggtctgacctcaggtagcttctctgaccagccaggctcactgatgtggcag
cacatgtcagtgcctgaacttgtggctcagctggttgatgaccccttcatccagggtctg
ctgtccaacacgggcctaatgcgccagctggttcttgataatcctcacatgcagcagctg
atccagcagaaccctgagattggtcatattcttaataaccccgagatcatgcggcagaca
atggagtttttacgtaacccttccatgatgcaggagatgatgcgtagccaggatcgagca
ctcagtaacctggagagcatccctggtggctacaatgtgctgcgtactatgtacacagat
attatggatcccatgcttaatgcggtacaggagcagtttggtggcaatccttttgctact
gctactactgctagtaccaccaccaccagcagccaaccctcaaggacagagaactgtgac
cctcttcccaatccctggacttccacttgtggggtttcaggtagcagacaagggagacag
cctggggaccaggatacatctgagagtagaaataggcttccaagctttctgggtaacata
ggactctttgattatctccaacagttacacgagacttctcaggccctgggatcctacctg
cagggtactgtgccaactccaagttcaagccaggaaacaccactatcaggaaacagagtt
cctccaaatttacccccatcccctaaacctgggtcaggccaacctctgcccaaagactca
gtagcaatcaagggaaagtcgtcctgcccagctttcttgagacattcatctgagaacagt
actggacaaggtggaagcctacatgattcagggaagagctctactggcccgagtactggc
ctgcccaatcttacctctcagataggggataatgccaacagatccccatttgtttctaca
ccatcatcccttatatcacctactcctggagccccagaatctccctggcttcctccaaca
ggttacccaagatctctgagatcagctttaacaaatcaagtccctcgaatgcagaatgag
ctacatcaacagctcccactactgctgcaccttcagacagccatgacaaatccccgtgtc
atgcaagccttgctgcagattgagcagggtctgcagattctggctactgaagcaccccgc
ctcctgctctggttcatgccttgcctagcagggttgagtggtgtaataggaggtacagaa
tctagggaaggtgttgttatgtctgaggatccccgaccaaccccaacttctcagatttcc
ttagtacagggttctgcagagctaggtttccattcctccccctttctccaggtgttgcaa
gcgttagctagtaccaatccccagcagctacaactggaggctcacttccgggtacagctg
gagcaactacgggctatgggctttctgaatctggaagccaatctccaggccctcattgct
acagggggtgatgtagatgctgctgtggagaaactgaggaagtcttag

KEGG   Rattus norvegicus (rat): 310633
Entry
310633            CDS       T01003                                 

Gene name
Ubqln4
Definition
(RefSeq) ubiquilin-4
  KO
K04523  ubiquilin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    310633 (Ubqln4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    310633 (Ubqln4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    310633 (Ubqln4)
   03051 Proteasome [BR:rno03051]
    310633 (Ubqln4)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    310633 (Ubqln4)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    310633 (Ubqln4)
SSDB
Motif
Pfam: ubiquitin STI1 UBA Rad60-SLD Ubiquitin_5 YukD Rad60-SLD_2 DUF2407 HOIP-UBA CUE
Other DBs
NCBI-GeneID: 310633
NCBI-ProteinID: NP_001101158
RGD: 1308273
Ensembl: ENSRNOG00000019933
Vega: OTTRNOG00000002259
UniProt: D4A3P1
Position
2
AA seq 595 aa
MAEPSGAETRPQIRVTVKTPKDKEEILICDQASVKEFKEEISRRFKAQQDQLVLIFAGKI
LKDGDTLNQHGIKDGLTVHLVIKTPQKAQDPVTTTASSPSTPDSASAPSTTPASPAAPVQ
PCSSGNTTSDASSGGGPSPVAAEGPSNATASILSGFGGILGLGSLGLGSANFMELQQQMQ
RQLMSNPEMLSQIMENPLVQDMMSNPDLMRHMIMANPQMQQLMERNPEISHMLNNPELMR
QTMELARNPAMMQEMMRNQDRALSNLESVPGGYNALRRMYTDIQEPMFTAAREQFGNNPF
SSLAGNSDNSSSQPLRTENREPLPNPWSPSPPTSQAPGSGGEGTGGSGTSQVHPTVSNPF
GINAASLGSGMFNSPEMQALLQQISENPQLMQNVISAPYMRTMMQTLAQNPDFAAQMMVN
VPLFAGNPQLQEQLRLQLPVFLQQMQNPESLSILTNPRAMQALLQIQQGLQTLQTEAPGL
VPSLGSFGTPRTSVPLAGSNSGSAAEAPTASPGTPATTPPSAGSNTQQQLMQQMIQLLSG
SGNSQVPVPEVRFQQQLEQLNSMGFVNREANLQALIATGGDINAAIERLLGSQLS
NT seq 1788 nt   +upstreamnt  +downstreamnt
atggcggagccgagtggggctgagacgaggccccagattcgggtcaccgtcaagaccccc
aaggacaaggaggagatcctgatctgcgatcaagcctcggtcaaggagttcaaggaggaa
atctcccggaggtttaaggctcagcaggatcagctggtcctgatcttcgcaggcaagatc
ctcaaggatggagacacactgaaccagcatgggatcaaggacgggctcacggttcatcta
gtcatcaaaacccctcagaaggctcaagatccagtgactactactgcttcctccccatcc
actcctgactctgcctcagcaccctccaccacgcctgcctcacctgcggcccctgtccag
ccctgcagctctggcaatactacttcagatgctagcagtggaggggggccttctccagtg
gcggcagagggaccctcaaatgccactgcatcaattctttctggctttgggggcatcctg
ggcctgggcagcctgggcctgggctccgccaactttatggagctacagcaacagatgcag
cggcagctcatgtccaatcctgagatgctgtcgcagatcatggagaaccccctggtccag
gatatgatgtcaaaccctgacctgatgcgccacatgatcatggctaacccccagatgcaa
cagctgatggagaggaaccctgagatcagtcacatgctcaacaacccggagctcatgagg
cagacaatggagcttgctcgtaacccagccatgatgcaagaaatgatgcggaaccaggac
cgggccctcagcaacctggaaagtgtcccgggagggtataatgccctccgccgcatgtac
acggacatccaggaacccatgttcactgctgcccgggaacagtttggcaacaatcccttc
tcttccctggccgggaactccgacaactcatcctcccaacctcttcggactgagaatcga
gagcccctccctaacccctggagcccctcgccccccacctcccaggcccccgggtccggt
ggggagggcaccggaggatcggggaccagccaggtgcacccgacagtctcgaaccccttt
gggatcaatgcggctagcctggggtcagggatgttcaacagcccagaaatgcaggcgctg
ctccagcagatttctgaaaacccccagctgatgcagaatgtcatctcggccccttacatg
cgcaccatgatgcagacgcttgcccagaaccctgactttgctgctcagatgatggtgaat
gtaccgctgtttgcagggaatccacaactccaggagcagctgcgcctgcagctccctgta
tttctgcagcagatgcagaacccagagtctctctccatcctcaccaacccacgggccatg
caagccttgctgcagatccagcaggggctgcagaccctccagactgaagcccctgggcta
gtacccagccttggctcctttgggacaccccggacctcggtacctttggcaggcagcaac
tctggatctgcagccgaggcccccactgcttccccaggcacaccagccacaactcctccc
agtgcgggttccaatacccagcagcaactcatgcagcagatgatccaacttttgtctgga
agtgggaactcacaggttccagtgccagaagtgagatttcaacagcagctggagcagctc
aactccatgggctttgtcaaccgtgaggccaacctacaagccctgatcgccacaggaggg
gacatcaatgcggctattgagagactcctgggatcccagctctcctga

KEGG   Rattus norvegicus (rat): 317396
Entry
317396            CDS       T01003                                 

Gene name
Ubqln2
Definition
(RefSeq) ubiquilin-2
  KO
K04523  ubiquilin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    317396 (Ubqln2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    317396 (Ubqln2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    317396 (Ubqln2)
   03051 Proteasome [BR:rno03051]
    317396 (Ubqln2)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    317396 (Ubqln2)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    317396 (Ubqln2)
SSDB
Motif
Pfam: ubiquitin STI1 UBA Rad60-SLD YukD Rad60-SLD_2 DUF2407 Ubiquitin_5 ATG8 Ubiquitin_4 CUE
Other DBs
NCBI-GeneID: 317396
NCBI-ProteinID: NP_001101721
RGD: 1563566
Ensembl: ENSRNOG00000003099
UniProt: D4AA63
Position
X
AA seq 638 aa
MAENGESSGPPRPSRGPAAAPGAANPPAEPKIIKVTVKTPKEKEEFAVPENSTVQQFKEA
ISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQATTQPSTTA
GTSTTTTTTTTAAAPPAATTSSAPRCSTTATTTNSSNLGLGSLASLGNLGLNSSNFTELQ
NQMQQQLLASPEMMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNP
DIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFG
GNPFATVGSSSSSGEGTQPSRTENRDPLPNPWAPPPTTQTSATTTTTTTSSGTVAGSNTS
STTAGNTMAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDMA
AQMMLSSPLFTANPQLQEQMRPQLPNFLQQMQSPETIAAMSNPRAMQALLQIQQGLQTLA
TEAPGLIPGFTPGVGVGVLGTAITPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPASSPG
STGTGIPPATTVSSSAPTETISPTSESGPSQQFIQQMVQALTGGSPPQPPNPEVRFQQQL
EQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggctgagaacggcgagagcagcggccccccgcgcccctcccgcggccctgctgcggcc
ccaggcgcggccaacccgccagccgagcccaaaatcatcaaagtcactgtgaagaccccc
aaagagaaggaggagttcgcggtgcccgagaacagcaccgtgcagcagttcaaggaagcg
atttctaaacgcttcaaatcgcaaaccgatcagctcgtgctgattttcgctggaaaaatc
ctgaaagatcaagacaccttgatccagcatggcatccatgatggactgactgttcacctg
gttatcaaaagccagaaccgtccgcagggccaggccaccacgcagcccagcactactgcg
ggaacgagcacgacgaccacgaccaccaccacggcggcggcgccgccggcggcgactaca
tcatcggctcccaggtgtagcaccacagctactaccacaaatagcagcaacttggggctc
ggaagccttgccagccttggtaacctgggtttgaactcgtccaacttcaccgagcttcag
aaccagatgcagcagcagctcttggccagccccgagatgatgatccagatcatggaaaat
ccctttgttcagagcatgctttcgaatcctgatctgatgaggcagctcatcatggccaat
ccacagatgcaacaattgatccagagaaacccagaaatcagccacctactgaacaaccca
gatataatgaggcagactctcgaaatcgccaggaatcctgccatgatgcaagagatgatg
agaaatcaagacctggctctcagtaatctcgaaagcatcccaggtggctacaatgctctg
cggcgcatgtacactgacattcaagaacccatgctgaatgccgcacaggagcagtttggg
ggcaatccgtttgccacggtggggagcagttcctcctcaggggaaggtactcagccttcc
cgcacggagaatcgggatccgctgcctaatccttgggcaccaccgccaactacccagacc
tctgcgacgaccaccaccacgaccacaagcagtggcactgtggctggcagcaacaccagc
agcactacggccgggaacaccatggctgcagctaattatgtggccagcatcttcagcacc
ccaggaatgcagagcctgctgcagcagataactgaaaatccccagctgattcagaatatg
ctgtctgcaccctacatgagaagcatgatgcagtcgctgagccagaatccagatatggct
gcccagatgatgctgagtagcccactgtttacggcgaatcctcagctgcaggagcagatg
cgtccacagctcccgaatttcctgcagcagatgcagagtccagaaaccatcgcggccatg
tcaaacccgagagcgatgcaagcgctactgcagatccagcaggggctacagacactagcc
actgaagcacctggcctcattccaggcttcactccaggtgtgggggtgggagtgctggga
acggccataacccctgtgggcccagtcactcccatagggcccatcggtcctatcgttcct
ttcacccccataggccccatcgggcctataggacccactggccctgccagctcccctggc
tcgaccggcaccgggatcccgcctgcaaccactgtgtccagctctgcacctactgaaacc
ataagtccaacatcagaatctggacccagccagcagttcattcagcaaatggtgcaggct
ctcactggaggaagtcctccacagccgccgaatcctgaagtgagatttcagcagcaactg
gaacagctcaacgccatggggttcttaaaccgcgaagcaaacttgcaggccctaatagca
acaggaggcgacatcaacgcggccattgagaggctgctgggctctcagccatcctaa

DBGET integrated database retrieval system