KEGG   Rattus norvegicus (rat): 114591
Entry
114591            CDS       T01003                                 

Gene name
Dpp3
Definition
(RefSeq) dipeptidylpeptidase 3
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    114591 (Dpp3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     114591 (Dpp3)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M49: dipeptidyl-peptidase III family
   114591 (Dpp3)
SSDB
Motif
Pfam: Peptidase_M49
Other DBs
NCBI-GeneID: 114591
NCBI-ProteinID: NP_446200
RGD: 621127
Ensembl: ENSRNOG00000031485
UniProt: O55096
Position
1q43
AA seq 738 aa
MADTQYILPNDIGVSSLDCREAFRLLSPTERLYAHHLSRAAWYGGLAVLLQTSPEAPYIY
ALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPK
EKLERVILGSKAAQQHPEEVRSLWQTCGELMFSLEPRLRHLGLGKEGVTTYFSGDCAMED
AKLAQDFLDSQNLSAYNTRLFKVVGQEGKYHYEVRLASVLNTEPALDSELTSKLKSYEFQ
GNHFQVTRGDYAPILQKVVEHLEKAKAYAANSHQEQMLAQYVESFTQGSIEAHKRGSRFW
IQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAMVNKDMSAKFERLVASAEQLLKELPWP
PAFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYATK
REKLTFMEEEDKDLYIRWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPE
TGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLYLCLNPQVLQIFGFEGTDAEDVIY
VNWLNMVRAGLLALEFYTPETANWRQAHMQARFVILRVLLEAGEGLVTVTPTTGSDGRPD
ARVHLDRSKIRSVGKPALERFLRRLQVLKSTGDVVAGRALYEGYAAVTDAPPECFLTLRD
TVLLRKESRKLIVQPNTRLEGSEVQLVEYEASAAGLIRSFCERFPEDGPELEEVLTQLAT
ADAQFWRDQVQEAPSGQA
NT seq 2217 nt   +upstreamnt  +downstreamnt
atggcagatacccagtacatcctgcccaatgacatcggtgtgtctagcctggactgccgg
gaggcattccgcctgctgtcacccacagagcgcctctatgcccatcacctgtctagagcc
gcttggtatggaggcctggctgtgctgctccagacatctcctgaagccccctacatctat
gccctgcttagccgcctcttccgtgcccaggaccctgaccagctacgccaacatgccctg
gctgagggcctgactgaagaagagtatcaggcattcctggtctacgctgcaggggtctac
tccaacatgggcaactataagtccttcggtgacaccaagtttgtccctaacctgcccaag
gaaaagctggagcgtgtgatccttgggagtaaggctgcccaacagcatccagaagaagtc
aggagcctttggcagacctgtggggagcttatgttctccctggaaccaaggcttcgacat
cttgggctggggaaggagggagtcaccacctatttctctggggattgtgccatggaagat
gccaagctggcccaggacttcctggactctcagaacctcagtgcatacaacacccggctc
ttcaaggtggtcggccaggaagggaagtaccactatgaggtgcgactggcttcagtactc
aacacagaacctgctctcgactctgagttgacttccaagctgaagagctacgagttccag
gggaatcatttccaggtcacccgtggggactatgcccccatcctccagaaggtggtagaa
cacttggagaaagctaaggcttatgcagccaatagccaccaggagcaaatgctggcccag
tatgtggagagcttcacccagggttccattgaggcccataagaggggctcccgcttctgg
attcaggacaaaggtcccattgtagagagttacattggcttcattgagagctaccgtgac
ccctttggctcccgaggagaatttgaaggcttcgtggccatggtaaacaaagacatgagt
gcaaagttcgagcggctggttgcaagtgctgagcagctgctgaaggagctgccttggcct
cctgcctttgagaaggacaagttcctcacccctgacttcacttccctggatgtccttacc
tttgccggctctggcatccctgcaggcatcaacatccccaactatgatgacctgagacag
acagagggctttaagaatgtgtctctggggaatgtgctggctgtggcctatgccacaaag
cgggagaaactcaccttcatggaggaagaagacaaggacctgtacatccgctggaagggg
ccgtcctttgatgtgcaggtggggttacatgagctgttgggccatggcagcggcaagctc
tttgtacaggatgagaaaggtgctttcaactttgaccaggagacagtgatcaacccagag
actggggagcagatccagagctggtaccggagtggagagacatgggatagcaaatttagc
accattgcctccagctacgaagagtgccgggctgagagcgtgggcctctacctctgtctc
aacccccaagtacttcagatctttggctttgagggaactgacgcagaagatgtcatctat
gtgaactggctcaacatggtccgggctgggctgttggctttggagttctacaccccagag
acggccaactggcgacaggcccacatgcaggcccggtttgtgatcctgagggttttgctg
gaagctggcgaaggactcgttaccgtcacccccaccacaggctctgatgggcgcccagat
gctcgtgtccacctggaccgcagcaagatccggtcagtgggcaaacctgctttggagcgg
ttcctccggagactgcaggtgctgaagtccacaggggatgtggttgcagggcgcgccctg
tacgagggctatgcggcggtcactgacgcacccccagagtgcttcctcactctaagggac
acggtattgctgcgcaaggaatcccggaagcttattgtccagcccaacactcgcctggaa
ggctcagaagtgcaacttgtagagtatgaggcctcagcggctggtctcatccgatccttc
tgtgaacggtttccggaggatgggcctgagttggaggaggttcttacccagctggccaca
gcagatgctcaattctggagggatcaggtccaggaggccccatctggccaggcttga

DBGET integrated database retrieval system