KEGG   Rattus norvegicus (rat): 114593
Entry
114593            CDS       T01003                                 

Gene name
Nppc
Definition
(RefSeq) C-type natriuretic peptide precursor
  KO
K12336  natriuretic peptide C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04270  Vascular smooth muscle contraction
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    114593 (Nppc)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    114593 (Nppc)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    114593 (Nppc)
SSDB
Motif
Pfam: ANP
Other DBs
NCBI-GeneID: 114593
NCBI-ProteinID: NP_446202
RGD: 620850
Ensembl: ENSRNOG00000018854
UniProt: P55207
Position
9
AA seq 126 aa
MHLSQLIACALLLALLSLRPSEAKPGTPPKVPRTPPGEELAEPQAAGGNQKKGDKTPGGG
GANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS
MSGLGC
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcacctctcccagctgatcgcctgtgccctgctgctcgcgctactctcactccggccc
tccgaagccaagcccgggacaccaccgaaggtcccgagaaccccgccaggggaggagctg
gcagagccccaggcagctggtggcaatcagaaaaagggtgacaagactccaggcggcggg
ggagccaatctcaagggagaccgatcgcgactgcttcgggacctgcgtgtggacaccaag
tcccgggcggcgtgggctcgccttctgcacgagcaccccaacgcgcgcaaatacaaaggc
ggcaacaagaagggcttgtccaaaggctgctttggcctcaagctggaccggatcggctcc
atgagcggtctgggatgttag

DBGET integrated database retrieval system