KEGG   Rattus norvegicus (rat): 114596
Entry
114596            CDS       T01003                                 

Gene name
Wap
Definition
(RefSeq) whey acidic protein precursor
  KO
K17106  whey acidic protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    114596 (Wap)
SSDB
Motif
Pfam: WAP
Other DBs
NCBI-GeneID: 114596
NCBI-ProteinID: NP_446203
RGD: 621851
Ensembl: ENSRNOG00000055684
UniProt: P01174
Position
14
AA seq 137 aa
MRCFISLVLGLLALEVALARNLQEHVFNSVQSMCPDDSSSEDTECINCQTNEECAQNDMC
CPSSCGRPCKTPVNIEVQKAGRCPWNPIQMIAAGPCPKDNPCSIDSDCSGTMKCCNNGCI
MSCMDPEPESPTVISFQ
NT seq 414 nt   +upstreamnt  +downstreamnt
atgcgctgcttcatcagcctcgttcttggcctgctggccctggaggtagcccttgctcgg
aacctacaggaacatgtcttcaactcagttcagtccatgtgccctgatgacagctccagt
gaggacacagaatgtatcaactgtcaaaccaacgaggagtgtgcccagaatgacatgtgt
tgtcccagttcctgtggtaggccctgcaaaactcctgtcaacattgaggttcaaaaggct
ggccgctgcccctggaatccaatccagatgatcgctgctggaccatgcccaaaggacaac
ccatgctccatcgacagtgattgttctggcaccatgaaatgctgcaacaatggctgtatc
atgagttgtatggacccagaaccagaatctcctacagtgatatcctttcagtga

DBGET integrated database retrieval system