KEGG   Rattus norvegicus (rat): 114630
Entry
114630            CDS       T01003                                 

Gene name
Atp5mc3
Definition
(RefSeq) ATP synthase F(0) complex subunit C3, mitochondrial precursor
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    114630 (Atp5mc3)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    114630 (Atp5mc3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114630 (Atp5mc3)
   05012 Parkinson disease
    114630 (Atp5mc3)
   05014 Amyotrophic lateral sclerosis
    114630 (Atp5mc3)
   05016 Huntington disease
    114630 (Atp5mc3)
   05020 Prion disease
    114630 (Atp5mc3)
   05022 Pathways of neurodegeneration - multiple diseases
    114630 (Atp5mc3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    114630 (Atp5mc3)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 114630
NCBI-ProteinID: NP_001348329
RGD: 620052
Ensembl: ENSRNOG00000001596
Position
3
AA seq 141 aa
MFACAKLARTPALIRAGSRVAYRPISASVLSRPETRTGEGSTVFNGAQNGVCQLIRREFQ
TSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGF
ALSEAMGLFCLMVAFLILFAM
NT seq 426 nt   +upstreamnt  +downstreamnt
atgttcgcctgcgccaagctcgcccgcacccctgctctgatccgagctggatccagagtt
gcatatagaccaatttctgcatcagtattatctcgaccagagactaggactggagagggc
tctacggtatttaatggggcccagaatggtgtgtgccagctgatccgaagggagttccag
accagtgtaatcagcagagatattgatactgctgccaaattcattggtgcaggtgctgcc
acagtaggagttgctggttctggtgctggtattggaacagtctttggcagtcttatcatt
ggctatgccagaaacccttcactgaagcagcagctgttctcatacgctatcctgggattt
gccttgtctgaagctatgggtctcttttgtttgatggttgcgttcttgatcttgtttgcc
atgtaa

KEGG   Rattus norvegicus (rat): 116550
Entry
116550            CDS       T01003                                 

Gene name
Atp5f1c
Definition
(RefSeq) ATP synthase subunit gamma, mitochondrial
  KO
K02136  F-type H+-transporting ATPase subunit gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    116550 (Atp5f1c)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    116550 (Atp5f1c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    116550 (Atp5f1c)
   05012 Parkinson disease
    116550 (Atp5f1c)
   05014 Amyotrophic lateral sclerosis
    116550 (Atp5f1c)
   05016 Huntington disease
    116550 (Atp5f1c)
   05020 Prion disease
    116550 (Atp5f1c)
   05022 Pathways of neurodegeneration - multiple diseases
    116550 (Atp5f1c)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    116550 (Atp5f1c)
SSDB
Motif
Pfam: ATP-synt ACT_4
Other DBs
NCBI-GeneID: 116550
NCBI-ProteinID: NP_446277
RGD: 620011
Ensembl: ENSRNOG00000019223
UniProt: Q6PCU0
Structure
PDB: 
1MAB 2F43

Position
17
AA seq 298 aa
MFSRASIVGLSACSLQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAE
RELKPARVYGTGSLALYEKAEIKGPEDKKKHLIIGVSSDRGLCGAIHSSVAKQMKNDMAA
LTAAGKEVMIVGIGEKIKSILYRTHSDQFLVSFKDVGRKPPTFGDASVIALELLNSGYEF
DEGSIIFNQFKSVISYKTEEKPIFSFSTVVAAENMSIYDDIDADVLQNYQEYNLANIIYY
SLKESTTSEQSARMTAMDNASKNASDMIDKLTLTFNRTRQAVITKELIEIISGAAALD
NT seq 897 nt   +upstreamnt  +downstreamnt
atgttctcgcgggcgagtattgtcgggctgtcggcctgctccttgcagccgcaatggatc
caagttcgaaacatggcaaccctgaaagacattaccaggagactgaagtccatcaaaaac
atccagaagattaccaagtctatgaagatggtggcagcagcgaagtacgcccgggctgag
cgggagctgaagccagctcgagtgtatgggacaggctccttggctctgtatgagaaggct
gagattaagggacctgaggacaagaagaagcacctcattattggtgtgtcctcggatcga
ggcctttgtggtgctattcattcctccgtggctaaacaaatgaagaatgacatggctgcc
ctcacagcagctgggaaagaagttatgattgttggaattggtgaaaaaatcaagagcata
ctttataggactcactctgatcagtttttggtgtccttcaaagacgtggggcggaagccc
cctacttttggagatgcatcggtcattgccttggagttgttaaattcgggatatgaattt
gatgaaggctctattatctttaatcagttcaagtctgttatctcctacaagacagaagag
aagcccatcttctctttcagtaccgtcgtggctgctgagaacatgagcatttatgatgac
attgatgctgacgtgctgcagaattaccaggaatacaatctggccaacatcatctactac
tccctgaaggagtccaccaccagtgagcagagtgccaggatgaccgccatggacaacgcc
agcaagaacgcctctgatatgattgataaattgacgctgactttcaaccgcacccgccag
gccgtcatcacgaaggagctgatagagatcatctccggggctgctgctctggattaa

KEGG   Rattus norvegicus (rat): 171082
Entry
171082            CDS       T01003                                 

Gene name
Atp5mc2
Definition
(RefSeq) ATP synthase F(0) complex subunit C2, mitochondrial precursor
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    171082 (Atp5mc2)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    171082 (Atp5mc2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    171082 (Atp5mc2)
   05012 Parkinson disease
    171082 (Atp5mc2)
   05014 Amyotrophic lateral sclerosis
    171082 (Atp5mc2)
   05016 Huntington disease
    171082 (Atp5mc2)
   05020 Prion disease
    171082 (Atp5mc2)
   05022 Pathways of neurodegeneration - multiple diseases
    171082 (Atp5mc2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    171082 (Atp5mc2)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 171082
NCBI-ProteinID: NP_598240
RGD: 620051
Ensembl: ENSRNOG00000015320
UniProt: Q06646
Position
7
AA seq 141 aa
MYACSKFVSTRSLIRSTSQLLSRPLSAVELKRPQMPTDEGLSCLAVRRPLTSLIPSRSFQ
TSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGF
ALSEAMGLFCLMVAFLILFAM
NT seq 426 nt   +upstreamnt  +downstreamnt
atgtatgcctgctccaagttcgtctctacccgctccctgatcaggagcacctctcagctg
ctgagccgtccgctctctgcagtggagttaaagcgaccacagatgcccacagatgagggc
ctcagctgcttggcagtccggcggcctctgacctcgcttatccctagccgcagcttccaa
accagcgccatttcaagggacattgacacagctgccaagttcattggagctggggctgct
acagttggggtggccggttctggagcaggaattgggactgtttttgggagtctcatcatt
ggctatgccaggaacccctctctgaagcagcaactcttctcctatgcgattctgggcttc
gccctctctgaggccatggggctcttttgcctaatggtggccttcctcatcctcttcgcc
atgtga

KEGG   Rattus norvegicus (rat): 171374
Entry
171374            CDS       T01003                                 

Gene name
Atp5f1b
Definition
(RefSeq) ATP synthase subunit beta, mitochondrial precursor
  KO
K02133  F-type H+-transporting ATPase subunit beta [EC:7.1.2.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    171374 (Atp5f1b)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    171374 (Atp5f1b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    171374 (Atp5f1b)
   05012 Parkinson disease
    171374 (Atp5f1b)
   05014 Amyotrophic lateral sclerosis
    171374 (Atp5f1b)
   05016 Huntington disease
    171374 (Atp5f1b)
   05020 Prion disease
    171374 (Atp5f1b)
   05022 Pathways of neurodegeneration - multiple diseases
    171374 (Atp5f1b)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    171374 (Atp5f1b)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     171374 (Atp5f1b)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N ATPase_2 NB-ARC RsgA_GTPase ATPase NACHT AAA_16 AAA_19 ABC_tran DUF5832 DUF2075
Other DBs
NCBI-GeneID: 171374
NCBI-ProteinID: NP_599191
RGD: 621368
Ensembl: ENSRNOG00000002840
UniProt: P10719
Structure
PDB: 
1MAB 2F43

Position
7
AA seq 529 aa
MLSLVGRVASASASGALRGLNPLAALPQAHLLLRTAPAGVHPARDYAAQSSAAPKAGTAT
GQIVAVIGAVVDVQFDEGLPPILNALEVQGRESRLVLEVAQHLGESTVRTIAMDGTEGLV
RGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFIEMSVEQ
EILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERT
REGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQD
VLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAI
YVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDV
ARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGK
LVPLKETIKGFQQILAGDYDHLPEQAFYMVGPIEEAVAKADKLAEEHGS
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgttgagtcttgtggggcgtgtggcctcggcctcggcctccggggccttacggggactc
aaccctttggcggcgctgccacaggcgcatcttctactacgaaccgctcccgccggggtc
catcctgccagagactatgcggcgcagtcgtctgcggccccgaaggcaggcaccgccacc
gggcaaattgtggcagtcatcggcgccgttgtggatgtccagttcgatgagggattacca
cctatcctaaatgccttggaagtgcaaggcagggagagcagactggttttggaggtagcc
cagcatttaggggagagcaccgtcagaactattgctatggatggcactgaaggcttggtt
agaggccagaaagtactggattcgggggcaccaatcaaaattcctgttggtcctgagacc
ttgggcagaatcatgaatgtcattggagaacctattgatgagagaggtcctatcaaaacc
aaacaattcgctcctattcatgctgaggctcctgaattcatagagatgagtgttgaacag
gaaattctggtgactggtataaaggttgtggatctgctggccccatacgccaagggtggg
aaaatcggactcttcggaggtgctggtgttggaaagacagtactgatcatggagctaatc
aacaatgttgctaaagcccatggtggttattctgtatttgctggtgttggtgagaggacc
cgtgagggcaatgatttataccatgaaatgattgagtctggtgttatcaacctaaaagat
gccacttccaaggtagcgttggtatatgggcagatgaatgaaccgcctggtgctcgtgcc
cgggtagctctgactggtctgactgttgctgaatacttcagagaccaggaaggccaagat
gtcctgctgtttattgacaacatcttccgcttcacccaggctggctcagaggtatctgcc
ttattgggcaggatcccgtctgctgtaggctaccagcctaccctagccactgacatgggt
acaatgcaggaaagaatcaccaccaccaagaagggctcgatcacctcagtgcaggctatc
tatgtgccagctgatgacctgactgaccctgcccctgcaactacctttgcccatttggat
gctactactgtgctgtcccgtgctattgctgagttgggcatctatccagctgtggatcca
ctggactccacctctcgaattatggatcccaacatcgttggcagtgagcattatgatgtt
gctcgtggggtgcaaaagatcctgcaggactacaaatctctccaggacatcattgccatc
ttgggtatggatgaactttctgaggaagataaattgactgtgtccagggcaaggaagata
cagcgcttcttgtcacagccattccaggttgctgaggtcttcacaggtcacatgggaaag
ctggtgcccctgaaggagaccattaaaggattccagcagatcttagcaggtgactatgac
catctcccggaacaagccttctacatggtgggacccattgaagaagctgtggcaaaggct
gacaagctggcagaggagcatgggtcgtga

KEGG   Rattus norvegicus (rat): 171375
Entry
171375            CDS       T01003                                 

Gene name
Atp5pb
Definition
(RefSeq) ATP synthase F(0) complex subunit B1, mitochondrial precursor
  KO
K02127  F-type H+-transporting ATPase subunit b
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    171375 (Atp5pb)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    171375 (Atp5pb)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    171375 (Atp5pb)
   05012 Parkinson disease
    171375 (Atp5pb)
   05014 Amyotrophic lateral sclerosis
    171375 (Atp5pb)
   05016 Huntington disease
    171375 (Atp5pb)
   05020 Prion disease
    171375 (Atp5pb)
   05022 Pathways of neurodegeneration - multiple diseases
    171375 (Atp5pb)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    171375 (Atp5pb)
SSDB
Motif
Pfam: Mt_ATP-synt_B TraQ DUF5752 DUF4423 DUF2105 Lambda_Kil
Other DBs
NCBI-GeneID: 171375
NCBI-ProteinID: NP_599192
RGD: 620041
Ensembl: ENSRNOG00000046299
Vega: OTTRNOG00000000721
UniProt: P19511
Position
2
AA seq 256 aa
MLSRVVLSAAATAAPCLKNAAVLGPGVLQATRVFHTGQPRLAPLPPLPEYGGKVRLGLIP
EEFFQFLYPKTGVTGPYVLGTGLSLYFLSKEIYVITPETFSTISVVGLIVYVIKKYGASI
GEFIDKLNEEKIAQLEEIKQSSMKQIQDAINREKAQQALVQKRHYLFDVQRNNIALALEV
TYRERLHKAYKEVKNRLDYHISVQDMMRRKEGEHMINWVEKHVIQSISAQQEKETIAKCI
GDLKMLAKKAQAQPIM
NT seq 771 nt   +upstreamnt  +downstreamnt
atgctgtcccgggtggtactttctgccgccgccacagcggccccgtgtctgaagaacgcg
gccgtcctgggtccaggggttttacaggcaacaagggtctttcacacaggacagcctcgc
cttgcccctctaccacctcttcctgaatatggaggaaaagtacgtcttgggctgattcct
gaggaatttttccagttcctttaccctaagactggtgtaacaggaccctacgtgcttgga
actgggcttagcttgtactttctatccaaagaaatatatgtgattaccccagagaccttc
tctaccatatcagtagtagggttgattgtctatgtgattaagaaatatggcgcctctatt
ggagaatttattgacaaacttaatgaggaaaaaattgctcaactagaagaaataaagcag
tcaagcatgaagcaaatccaggatgcaatcaacagggagaaggcacagcaggcactggtt
cagaagcgccactacctcttcgatgttcagaggaataacattgccctggccttggaggtc
acttaccgggaacgactacataaagcatataaggaggtaaagaatcgcctggactaccat
atttctgtacaggacatgatgcgtcgcaaggagggagagcacatgataaactgggtggag
aagcatgtgatacagagcatttctgcacagcaggaaaaggagaccattgccaagtgcatc
ggagatctaaagatgcttgcaaagaaggctcaagctcagccaattatgtga

KEGG   Rattus norvegicus (rat): 192241
Entry
192241            CDS       T01003                                 

Gene name
Atp5po
Definition
(RefSeq) ATP synthase subunit O, mitochondrial precursor
  KO
K02137  F-type H+-transporting ATPase subunit O
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    192241 (Atp5po)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    192241 (Atp5po)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    192241 (Atp5po)
   05012 Parkinson disease
    192241 (Atp5po)
   05014 Amyotrophic lateral sclerosis
    192241 (Atp5po)
   05016 Huntington disease
    192241 (Atp5po)
   05020 Prion disease
    192241 (Atp5po)
   05022 Pathways of neurodegeneration - multiple diseases
    192241 (Atp5po)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    192241 (Atp5po)
SSDB
Motif
Pfam: OSCP
Other DBs
NCBI-GeneID: 192241
NCBI-ProteinID: NP_620238
RGD: 621379
Ensembl: ENSRNOG00000001991
UniProt: Q06647
Position
11
AA seq 213 aa
MAAPATSVLSRQVRSFSTSVVRPFSKLVRPPVQVYGIEGRYATALYSAASKQKRLDQVEK
ELLRVGQLLKDPKVSLAVLNPYIKRSIKVKSLKDITTKEKFSPLTANLMNLLAENGRLGN
TQGVISAFSTIMSVHRGEVPCTVTTAFPLDEAVLSELKTVLNSFLSKGQILNLEVKTDPS
IMGGMIVRIGEKYVDMSAKSKIQKLSKAMRDLL
NT seq 642 nt   +upstreamnt  +downstreamnt
atggccgcaccagcaacatccgtgctgtcccgacaggtgcggagtttcagcacatctgtg
gtcaggcccttttcgaagcttgtaaggccccctgtccaggtctacggcatcgaaggccgc
tatgcaaccgccctgtactctgctgcgtctaagcagaaaaggctggaccaggtggaaaag
gagttgctgcgagtggggcaactcttgaaggaccccaaggtgtcccttgctgttctgaac
ccctacattaagcgctccatcaaagtgaaaagcctgaaggacatcactacaaaggaaaaa
ttctctccgctgacggccaacctcatgaatttacttgctgaaaatggtcgcctaggcaac
acccagggcgtcatctctgccttctccaccatcatgagtgtccaccgtggagaagtgccg
tgcacagtgaccacagcgtttcctttagatgaagctgttctctctgagttaaagacagtg
ctgaatagcttcctgagtaaaggccagatactgaacctggaggtcaagactgacccatca
atcatgggtgggatgattgtccgaattggagagaaatacgttgatatgtctgcaaagagc
aagattcagaagctcagcaaggccatgcgggatctgctctga

KEGG   Rattus norvegicus (rat): 245958
Entry
245958            CDS       T01003                                 

Gene name
Atp5f1e
Definition
(RefSeq) ATP synthase subunit epsilon, mitochondrial
  KO
K02135  F-type H+-transporting ATPase subunit epsilon
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    245958 (Atp5f1e)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    245958 (Atp5f1e)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    245958 (Atp5f1e)
   05012 Parkinson disease
    245958 (Atp5f1e)
   05014 Amyotrophic lateral sclerosis
    245958 (Atp5f1e)
   05016 Huntington disease
    245958 (Atp5f1e)
   05020 Prion disease
    245958 (Atp5f1e)
   05022 Pathways of neurodegeneration - multiple diseases
    245958 (Atp5f1e)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    245958 (Atp5f1e)
SSDB
Motif
Pfam: ATP-synt_Eps
Other DBs
NCBI-GeneID: 245958
NCBI-ProteinID: NP_620799
RGD: 621374
Ensembl: ENSRNOG00000049912
UniProt: P29418
Position
3
AA seq 51 aa
MVAYWRQAGLSYIRFSQICAKAVRDALKTEFKANAEKTSGTSIKTVKIKKE
NT seq 156 nt   +upstreamnt  +downstreamnt
atggtggcgtactggcgacaggctggactcagctacatccggttctcccagatctgtgca
aaagcagtgagggatgccctgaagactgagttcaaagcgaacgctgagaagacttcgggc
accagcataaaaacagtgaaaataaagaaggagtag

KEGG   Rattus norvegicus (rat): 245965
Entry
245965            CDS       T01003                                 

Gene name
Atp5f1d
Definition
(RefSeq) ATP synthase subunit delta, mitochondrial precursor
  KO
K02134  F-type H+-transporting ATPase subunit delta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    245965 (Atp5f1d)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    245965 (Atp5f1d)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    245965 (Atp5f1d)
   05012 Parkinson disease
    245965 (Atp5f1d)
   05014 Amyotrophic lateral sclerosis
    245965 (Atp5f1d)
   05016 Huntington disease
    245965 (Atp5f1d)
   05020 Prion disease
    245965 (Atp5f1d)
   05022 Pathways of neurodegeneration - multiple diseases
    245965 (Atp5f1d)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    245965 (Atp5f1d)
SSDB
Motif
Pfam: ATP-synt_DE_N
Other DBs
NCBI-GeneID: 245965
NCBI-ProteinID: NP_620806
RGD: 621372
Ensembl: ENSRNOG00000014625
UniProt: P35434
Position
7
AA seq 168 aa
MLPAALLRHPGLRRLVLQARTYAQAAASPAPAAGPGQMSFTFASPTQVFFDGANVRQVDV
PTLTGAFGILASHVPTLQVLRPGLVVVHAEDGTTTKYFVSSGSVTVNADSSVQLLAEEVV
TLDMLDLGAARANLEKAQSELSGAADEAARAEIQIRIEANEALVKALE
NT seq 507 nt   +upstreamnt  +downstreamnt
atgctgcccgccgcattgcttcgtcacccaggtctgcgccgtctggtgctccaggcgcgt
acgtacgcccaggccgccgcctcacctgcccccgccgctgggcctggacagatgtccttc
accttcgcctccccgacgcaggtgttctttgatggtgccaatgtccggcaagtggatgtg
cctacgctgactggagcctttggcatcctggcatcccatgtccccacactacaggtccta
cggcctgggctggtagtggttcatgcggaagatggcaccacaactaagtattttgtgagc
agcggctccgtcactgtgaatgcggactcctctgtgcaattactagctgaagaagtcgtg
acactggacatgctggacctcggggcagcccgggcaaacctggagaaggcgcagtcagag
ctgtcaggggcagcagatgaggcagcacgggctgagatccaaatccggatcgaggccaat
gaagccctggtgaaggccctggagtag

KEGG   Rattus norvegicus (rat): 26196
Entry
26196             CDS       T01003                                 

Gene name
ATP8
Definition
(RefSeq) ATP synthase F0 subunit 8
  KO
K02125  F-type H+-transporting ATPase subunit 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    26196 (ATP8)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    26196 (ATP8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26196 (ATP8)
   05012 Parkinson disease
    26196 (ATP8)
   05014 Amyotrophic lateral sclerosis
    26196 (ATP8)
   05016 Huntington disease
    26196 (ATP8)
   05020 Prion disease
    26196 (ATP8)
   05022 Pathways of neurodegeneration - multiple diseases
    26196 (ATP8)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    26196 (ATP8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    26196 (ATP8)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   F-type ATPase
    26196 (ATP8)
SSDB
Motif
Pfam: ATP-synt_8
Other DBs
NCBI-GeneID: 26196
NCBI-ProteinID: YP_665633
RGD: 621240
UniProt: P11608 Q8HIC8
Position
MT
AA seq 67 aa
MPQLDTSTWFITIISSMATLFILFQLKISSQTFPAPPSPKTMATEKTNNPWESKWTKTYL
PLSLPPQ
NT seq 204 nt   +upstreamnt  +downstreamnt
atgccacaactagacacatccacatgatttattacaatcatctcctcaatagccacacta
tttattttatttcaattaaaaatttcttcccaaacctttcctgcacctccctcccccaaa
actatagccacagaaaaaacgaataacccttgagaatcaaaatgaacgaaaacctatttg
cctctttcattacccccacaataa

KEGG   Rattus norvegicus (rat): 26197
Entry
26197             CDS       T01003                                 

Gene name
ATP6
Definition
(RefSeq) ATP synthase F0 subunit 6
  KO
K02126  F-type H+-transporting ATPase subunit a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    26197 (ATP6)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    26197 (ATP6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26197 (ATP6)
   05012 Parkinson disease
    26197 (ATP6)
   05014 Amyotrophic lateral sclerosis
    26197 (ATP6)
   05016 Huntington disease
    26197 (ATP6)
   05020 Prion disease
    26197 (ATP6)
   05022 Pathways of neurodegeneration - multiple diseases
    26197 (ATP6)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    26197 (ATP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    26197 (ATP6)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   F-type ATPase
    26197 (ATP6)
SSDB
Motif
Pfam: ATP-synt_A
Other DBs
NCBI-GeneID: 26197
NCBI-ProteinID: YP_665634
RGD: 621239
UniProt: P05504 Q8HIC7
Position
MT
AA seq 226 aa
MNENLFASFITPTMMGLPIVVTIIMFPSILFPSSERLISNRLHSFQHWLIKLIIKQMMLI
HTPKGRTWALMIVSLIMFIGSTNLLGLLPHTFTPTTQLSMNLSMAIPLWAGAVILGFRHK
LKNSLAHFLPQGTPISLIPMLIIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLV
LMDISPPTATITFIILLLLTVLEFAVALIQAYVFTLLVSLYLHDNT
NT seq 681 nt   +upstreamnt  +downstreamnt
atgaacgaaaacctatttgcctctttcattacccccacaataataggtctaccaattgtt
gtaaccattattatgttcccatcaattctattcccatcatcagaacgcctaatcagcaac
cgactacactcatttcaacactgactaatcaaacttatcatcaaacaaataatgttaatc
cacacaccaaaaggacgaacctgagccctaataattgtatccctaattatatttattggc
tcaaccaaccttctagggcttcttccccatacatttacccctaccactcagctatctata
aacctaagcatagccatccccctatgagcaggagccgtaattctaggcttccgacacaaa
ctaaaaaattctttagcccacttcttaccgcaaggaacccccatctccctaattcccata
ctaattatcatcgaaactatcagcctatttattcaaccgatagcactagcagtacgacta
acagcaaacattacagcaggccatctattaatgcatctaatcggaggagctactctagta
cttatagacatcagcccaccaaccgctacaattacatttattattctacttctacttaca
gtacttgaatttgccgtagccttaattcaagcctatgtattcacccttctagtaagcctg
tacctacatgataacacataa

KEGG   Rattus norvegicus (rat): 29754
Entry
29754             CDS       T01003                                 

Gene name
Atp5mc1
Definition
(RefSeq) ATP synthase F(0) complex subunit C1, mitochondrial precursor
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    29754 (Atp5mc1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    29754 (Atp5mc1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29754 (Atp5mc1)
   05012 Parkinson disease
    29754 (Atp5mc1)
   05014 Amyotrophic lateral sclerosis
    29754 (Atp5mc1)
   05016 Huntington disease
    29754 (Atp5mc1)
   05020 Prion disease
    29754 (Atp5mc1)
   05022 Pathways of neurodegeneration - multiple diseases
    29754 (Atp5mc1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    29754 (Atp5mc1)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 29754
NCBI-ProteinID: NP_059007
RGD: 61933
Ensembl: ENSRNOG00000007235
UniProt: Q06645
Position
10
AA seq 136 aa
MQTTKALLISPVLIRSCTRGLIRPVSASLLSRPEAPSKKPSCCSSPLQVARREFQTSVIS
RDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEA
MGLFCLMVAFLILFAM
NT seq 411 nt   +upstreamnt  +downstreamnt
atgcagaccacgaaggcactgctcatttctccagttctgatccgctcctgtaccaggggt
ctaatcaggcctgtgtctgcctccctcctgagtagaccagaggctccatctaaaaagcct
tcctgctgcagctcccctctccaggtggccagacgggaattccagaccagtgttatttcc
cgggacattgacacagcagccaagtttattggtgctggggccgccacagttggtgtggct
ggatcaggggctggcattggcacagtgtttggtagcttgattattggctatgccaggaac
ccgtctctcaagcagcagctcttctcctatgccatcctgggctttgccctgtctgaggcc
atggggctcttctgtttgatggtcgccttcctcatcctcttcgccatgtga

KEGG   Rattus norvegicus (rat): 641434
Entry
641434            CDS       T01003                                 

Gene name
Atp5pd
Definition
(RefSeq) ATP synthase subunit d, mitochondrial
  KO
K02138  F-type H+-transporting ATPase subunit d
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    641434 (Atp5pd)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    641434 (Atp5pd)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    641434 (Atp5pd)
   05012 Parkinson disease
    641434 (Atp5pd)
   05014 Amyotrophic lateral sclerosis
    641434 (Atp5pd)
   05016 Huntington disease
    641434 (Atp5pd)
   05020 Prion disease
    641434 (Atp5pd)
   05022 Pathways of neurodegeneration - multiple diseases
    641434 (Atp5pd)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    641434 (Atp5pd)
SSDB
Motif
Pfam: Mt_ATP-synt_D RE_Eco47II Cep57_CLD
Other DBs
NCBI-GeneID: 641434
NCBI-ProteinID: NP_062256
RGD: 620083
Ensembl: ENSRNOG00000003626
UniProt: P31399
Position
10
AA seq 161 aa
MAGRKLALKTIDWVSFVEIMPQNQKAIGNALKSWNETFHTRLASLSEKPPAIDWAYYRAN
VDKPGLVDDFKNKYNALKIPVPEDKYTALVDAEEKEDVKNCAQFVTGSQARVREYEKQLE
KIKNMIPFDQMTIDDLNEVFPETKLDKRKYPYWPHQPIENL
NT seq 486 nt   +upstreamnt  +downstreamnt
atggctgggcgcaaacttgctctaaaaaccatcgattgggtatcttttgtggagatcatg
ccccaaaaccagaaggcaattggaaacgctctgaagtcctggaatgagaccttccacacc
aggttggctagtctgtctgagaaaccaccagcgattgactgggcttactacagggccaat
gtggacaagcctggcttggtggatgattttaaaaacaagtataatgctctgaagatccct
gtgcctgaggataaatacacagccctagtggacgccgaggagaaggaggatgtgaagaac
tgtgcccagttcgtgactggatctcaggctagggtccgggaatatgagaagcagctggag
aaaataaagaacatgattccctttgaccagatgacgattgatgacttgaatgaggtcttc
cctgaaaccaagctggacaagaggaagtacccatactggccccatcagcccatcgagaac
ctgtga

KEGG   Rattus norvegicus (rat): 65262
Entry
65262             CDS       T01003                                 

Gene name
Atp5f1a
Definition
(RefSeq) ATP synthase subunit alpha, mitochondrial precursor
  KO
K02132  F-type H+-transporting ATPase subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    65262 (Atp5f1a)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    65262 (Atp5f1a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    65262 (Atp5f1a)
   05012 Parkinson disease
    65262 (Atp5f1a)
   05014 Amyotrophic lateral sclerosis
    65262 (Atp5f1a)
   05016 Huntington disease
    65262 (Atp5f1a)
   05020 Prion disease
    65262 (Atp5f1a)
   05022 Pathways of neurodegeneration - multiple diseases
    65262 (Atp5f1a)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    65262 (Atp5f1a)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N DUF4142
Other DBs
NCBI-GeneID: 65262
NCBI-ProteinID: NP_075581
RGD: 619993
Ensembl: ENSRNOG00000017032
UniProt: P15999
Structure
PDB: 
1MAB 2F43

Position
18
AA seq 553 aa
MLSVRIAAAVARALPRRAGLVSKNALGSSFVGTRNLHASNTRLQKTGTAEMSSILEERIL
GADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFG
NDKLIKEGDIVKRTGAIVDVPVGDELLGRVVDALGNAIDGKGPVGSKIRRRVGLKAPGII
PRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKK
KLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF
RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDSFG
GGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSA
AQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMA
IEEQVAVIYAGVRGYLDKLEPSKITKFESAFLSHVVSQHQSLLGNIRSDGKISEQSDAKL
KEIVTNFLAGFEP
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgctgtccgtgcgcatcgccgcggccgtggcccgtgccctccctcgacgggcgggactg
gtctccaaaaatgccttggggtcatcttttgttggtacaagaaatctccatgcctctaac
actcgacttcagaagactggcactgccgagatgtcctccattctcgaggagcggatcctt
ggagctgatacttctgttgaccttgaagagactggccgtgtcttaagcattggtgatggt
attgcccgagtgcatggactgaggaacgttcaagctgaggagatggtagagttttcttcc
ggcttaaagggtatgtccctgaacttggaacccgacaatgttggagttgtcgtgtttggg
aatgacaagctaattaaagaaggtgatatcgtgaagagaacaggagccatcgtggacgtt
ccagttggcgatgaactgttgggccgtgtagttgatgccctgggaaatgccattgatggg
aagggtccagttggttccaagattcgcagacgagtgggcctgaaagcccctggaattatc
ccccgaatctctgtgcgggaaccaatgcagacgggcatcaaggctgtggatagcctggtg
ccgattggccgaggtcagcgtgagctgattattggagacagacagaccgggaaaacctcg
attgctattgacacaatcatcaaccagaagcgtttcaatgatgggactgacgagaagaag
aaactgtactgcatctacgttgctattggtcagaaacggtccaccgttgctcagttggtg
aagagactgacagacgcagatgccatgaagtacaccattgtggtgtcagccactgcctct
gatgctgccccgcttcagtacttggctccttactccggctgctccatgggagagtatttc
cgagataatggcaagcacgctctgatcatctatgacgacttatccaagcaggctgttgct
taccgccagatgtctctgctgctccgccgacccccgggtcgagaggcctatcccggtgat
gtgttttacctacactctcgcctgctggagagagcagccaagatgaacgattcctttggt
ggtggctctttgactgccttaccagtcattgaaacacaggctggtgatgtgtccgcctac
attccaacaaacgttatttccatcaccgatggacagatcttcttggaaacagaattgttc
tataaaggcatccgccctgccattaatgtgggcttgtctgtgtcccgtgtcggatctgcc
gcccagaccagagccatgaagcaggtggcaggcaccatgaagctggagttggcccagtac
cgggaggtcgctgcttttgcccagtttggttctgatctggatgctgccactcagcagctc
ttgagccgtggcgtgcgcctgaccgagctgctaaagcaaggacagtactctcccatggct
attgaagaacaggtggctgtcatctatgcaggcgtccggggttatcttgataaactggag
cccagtaagatcacaaagttcgagagtgctttcttgtctcatgttgtgagccagcaccag
agcctcttgggcaatatcaggtctgatgggaaaatctcagaacagtcggatgcaaagctg
aaggaaatcgtaacaaacttcttggctgggtttgaaccttaa

KEGG   Rattus norvegicus (rat): 94271
Entry
94271             CDS       T01003                                 

Gene name
Atp5pf
Definition
(RefSeq) ATP synthase-coupling factor 6, mitochondrial precursor
  KO
K02131  F-type H+-transporting ATPase subunit 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    94271 (Atp5pf)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    94271 (Atp5pf)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    94271 (Atp5pf)
   05012 Parkinson disease
    94271 (Atp5pf)
   05014 Amyotrophic lateral sclerosis
    94271 (Atp5pf)
   05016 Huntington disease
    94271 (Atp5pf)
   05020 Prion disease
    94271 (Atp5pf)
   05022 Pathways of neurodegeneration - multiple diseases
    94271 (Atp5pf)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    94271 (Atp5pf)
SSDB
Motif
Pfam: ATP-synt_F6 RICH
Other DBs
NCBI-GeneID: 94271
NCBI-ProteinID: NP_446054
RGD: 621376
Ensembl: ENSRNOG00000001551
UniProt: P21571
Position
11
AA seq 108 aa
MTVQRIFRLSSVLRSAVSVHLRRNIGVTAVAFNKELDPVQKLFLDKIREYKAKRLASGGP
VDTGPEYQQEVDRELFKLKQMYGKGEMDKFPTFNFEDPKFEVLDKPQS
NT seq 327 nt   +upstreamnt  +downstreamnt
atgactgttcagaggatcttcaggctctcctctgtccttcggtcagcagtctctgtgcat
ttgaggaggaacattggtgttacagctgtggcgtttaataaggaacttgatcctgtacag
aaactcttcttggacaagataagagagtacaaagcaaagcgactggcgtctggaggacct
gttgatactggcccagaatatcagcaagaggtggacagagagctttttaagcttaaacaa
atgtatggtaaaggagagatggataagtttcctaccttcaattttgaggatcccaaattt
gaagtcctcgacaaaccccagtcctga

DBGET integrated database retrieval system