KEGG   Rattus norvegicus (rat): 114632
Entry
114632            CDS       T01003                                 

Gene name
Aimp1, Emap2, Scye1
Definition
(RefSeq) aminoacyl tRNA synthetase complex-interacting multifunctional protein 1
  KO
K15437  aminoacyl tRNA synthase complex-interacting multifunctional protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rno03016]
    114632 (Aimp1)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    114632 (Aimp1)
SSDB
Motif
Pfam: tRNA_bind
Other DBs
NCBI-GeneID: 114632
NCBI-ProteinID: NP_446209
RGD: 620466
Ensembl: ENSRNOG00000011384
UniProt: Q4G079
Position
2q43
AA seq 315 aa
MIFCRFWGKMATNDAVLKRLEQKGAEADQIIEYLKQQVALLKEKAILQATLREEKKLQVE
NAKLKKEIEELKQELIQAEIHNGVKQVPVPSSSSLETHCSVSESVTRSASVTTTTMTGGG
GEEKKVKEKTEKKGEKKEKKQQSAAASADSKPVDVSRLDLRIGCIVTAKKHPDADSLYVE
EVDVGEAAPRTVVSGLVNHVPLEQMQNRMVVLLCNLKPAKMRGVLSQAMVMCASSPEKVE
ILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGAPFEVKG
KGVCRAQTMANSGIK
NT seq 948 nt   +upstreamnt  +downstreamnt
atgattttctgccgattctggggaaagatggccaccaatgatgctgttctgaagcggctg
gagcagaaaggcgcagaggcggatcagatcattgagtatctcaagcagcaggttgctctt
ctcaaggagaaagcaattttgcaggcaactttgagagaagaaaagaaacttcaagttgaa
aatgctaaactgaaaaaagaaatagaagaactaaagcaagagttgattcaggcagaaatt
cataatggagtgaagcaggtgcctgtcccatcgagttcttcactggagactcattgttcc
gtttctgaaagtgtgactcggtctgcatcagtaacaaccaccaccatgaccggaggggga
ggggaagaaaagaaggtaaaagagaagacggaaaagaaaggagagaaaaaggagaagaag
cagcagtcagcggcagcaagtgctgattcgaagcctgtcgacgtatcacgcctggatctt
cgaattggatgtattgtcactgccaaaaaacacccggatgcagattcgttgtatgtggag
gaagtcgatgtgggagaagcagctccacggacggtcgtcagcgggctggtgaatcatgtc
cctctagaacagatgcaaaaccggatggtggttttgctttgtaatctgaagcctgcaaaa
atgcggggagtgctgtcccaagcaatggtgatgtgcgccagttcaccagagaaagtggag
attttggcccctcccaacgggtctgttcctggagacagaattacttttgatgctttccct
ggagagcctgacaaggagctgaaccctaagaagaagatctgggagcagatccagcctgac
ctgcacaccaatgatgagtgtgtagccacatacaaaggagctccctttgaggtgaagggg
aagggagtttgcagggcccaaaccatggccaacagcggaattaaataa

DBGET integrated database retrieval system