KEGG   Rattus norvegicus (rat): 114635Help
Entry
114635            CDS       T01003                                 

Gene name
Trafd1, Fln29
Definition
(RefSeq) TRAF type zinc finger domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: zf_UBZ zf-TRAF zf_C2H2_6
Motif
Other DBs
NCBI-GeneID: 114635
NCBI-ProteinID: NP_446212
RGD: 620171
Ensembl: ENSRNOG00000001351
UniProt: G3V959
Position
12q16
AA seq 581 aa AA seqDB search
MAEFPDDQAARLCDNCKKEIPVFNFTIHEIHCQRNIGVCPVCKEPFPKSDMDIHVATEHC
QVTCKCNKKLEKRQLKQHVETECPLRLAVCQHCDLELSVVKLKEHEDYCGARTELCGSCG
RNVLVKELQTHPAVCGRVEEEKRSEAAVPPEAYDEPWSQDRIWIASQLLRQIEALDPPMR
LPGRPLRAFEADPFYSRTASQRGVTAHFPIQNNLFEEQERQERNRSHQSPKDSAENSAHL
DFMLALSLQNEGQASSMVEQGFWESVPEADPARAGPTSLGDIKGAADETLLPCEFCEELY
PEELLIDHQTSCNPSHALRSLNTGSSSIRGVEDPGAIFQNFLQQATSNQLDTLMGLSSSA
AVEDSIIIPCEFCGVQLEEEVLFHHQDQCDQRPATANHRAMEGIPTQDSQPEDRSPELSR
RRVKHQGDLSSGYMDDVKQESVKGSTYSLSPNRTMNNVSTCNRLLNSSGPRSDCQRSPPG
VLKLNNSGSQDIRGRIRGSQNGPIASAHAPVIHSIRNLYPENLAPSFPHGSPGRFGASGR
SEGSRSSRVTPTAASYHSRAAKAKPPKQQGAGDAEEEEEEE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtttccagatgaccaggctgctaggctgtgtgacaactgcaaaaaggaaatt
ccggtatttaattttaccatccatgaaatccactgtcaaaggaacattggtgtgtgccct
gtctgcaaggaaccattcccgaagtccgacatggacattcacgtggctacagagcactgt
caggtgacctgcaaatgcaacaagaagctggagaagaggcagttaaagcagcatgtggag
actgagtgtcctctgcgccttgctgtctgccagcactgtgatctggagctttctgttgtc
aagttgaaggagcatgaggattactgtggtgcccggacagagctgtgtggcagctgtggg
cgcaacgtgcttgtaaaggagttgcagactcaccctgctgtttgtgggagagtggaggag
gagaagagaagcgaggccgctgtccctcctgaggcttacgacgagccttggagtcaggat
agaatctggatcgcatcccagcttctcagacagatcgaggctctggacccacccatgagg
ctccctggaaggcccctgagagcctttgaggcagaccctttctacagtaggactgccagc
cagaggggcgtgacagcccattttcccattcaaaataatctttttgaagagcaagaaagg
caggaaaggaacagaagccaccagtccccaaaagacagtgctgagaatagcgcacacttg
gacttcatgttggccctgagtctgcagaatgagggacaggcctccagcatggtagagcag
ggcttctgggagtctgtgccggaggccgaccccgctcgtgctgggcccacatctctaggt
gacataaagggtgctgctgacgagactctcctgccctgtgagttctgtgaggagctgtac
ccggaggaactgctcattgaccatcagacaagctgcaacccttcacatgccttacgttca
ctcaatactggcagctcttccattaggggggtggaagatcctggtgccatcttccagaac
tttctacaacaagcaacaagtaaccagttagacactttaatgggcctgagcagttcagct
gctgtggaagacagcattatcatcccctgtgagttctgtggggtgcagctggaagaggag
gtgctgttccaccatcaggatcaatgtgaccagcgcccagccacagcaaaccaccgagca
atggagggcatccctacacaggattctcagcctgaagaccgttcaccagagctgtccagg
aggcgggtcaaacaccagggagacctgtcgtctggctacatggatgatgtcaagcaggaa
tcagtgaaaggctccacctactcgctgtctcccaacagaaccatgaacaatgtgtctacc
tgtaaccgactgttgaactcatcaggccccaggtctgactgccagcgtagccctcctggt
gtgctgaagctcaacaactcaggcagccaggacatccgtgggcggattagaggcagccag
aatgggcccatagcatctgcgcatgctccagtgatccactctattcgaaatctctatcca
gaaaaccttgcgccctcttttcctcatggctcccctgggagattcggagccagtgggagg
agtgaaggcagtcggagctctcgggtcacccctacagccgccagctaccacagcagagca
gcaaaggcaaagcctccgaagcagcagggagcaggggatgcagaggaggaggaagaggag
gagtaa

DBGET integrated database retrieval system