KEGG   Rattus norvegicus (rat): 114705
Entry
114705            CDS       T01003                                 

Gene name
Rgs14
Definition
(RefSeq) regulator of G-protein signaling 14
  KO
K17706  regulator of G-protein signaling 14
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    114705 (Rgs14)
SSDB
Motif
Pfam: RBD RGS GoLoco RGS12_us1 SopA RGS-like
Other DBs
NCBI-GeneID: 114705
NCBI-ProteinID: NP_446216
RGD: 620003
Ensembl: ENSRNOG00000015616
UniProt: O08773
Position
17
AA seq 544 aa
MPGKPKHLGVPNGRMVLAVSDGELTSTSGSQAQGEGRGSSLSIHSLPSGPSSPFSTDEQP
VASWAQSFERLLQDPRGLAYFTEFLKKEFSAENVTFWQACERFQQIPASDTKQLAQEAHN
IYHEFLSSQALSPVNIDRQAWLSEEVLAQPRPDMFRAQQLQIFNLMKFDSYARFVKSPLY
QECLLAEAEGRPLREPGSSHLGSPDTARKKPKLKPGKSLPLGVEELGQLPLAEGRPLRKS
FRREMPGGAVNSALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSGEGESESRPGK
YCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGKEQKALVLDQDCTV
LADQEVRLENRITFQLELVGLERVVRISAKPTKRLQEALQPILAKHGLSLDQVVLHRPGE
KQLVDLENLVSSVASQTLVLDTLPDAKTREASSIPPCRSQGCLPRTQTKDSHLPPLSSSL
SVEDASGSTGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPSQRPGSQ
EAPP
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgccagggaagcccaagcacttgggtgtccccaacgggcgcatggtcctggctgtctct
gatggagaactgaccagcacatcaggttcccaggcccagggtgagggcagaggcagctcc
ctcagcatccacagcctccccagtggccccagcagccccttctccactgatgagcagcct
gtggccagctgggcccagtcctttgagcggctgctgcaagacccacggggtctggcttac
ttcactgagttcctgaagaaggaattcagcgccgagaatgtaactttctggcaagcctgc
gagcgtttccaacagatcccagccagcgacaccaaacagctagctcaggaggcccacaac
atctaccatgagttcctgtccagccaggcactgagcccagtgaacatcgaccgacaggcc
tggcttagtgaggaggtgctggcccagcccaggcccgatatgttccgagcacagcagctt
cagatcttcaatttgatgaagttcgacagctacgcgcgcttcgtcaaatccccgctgtac
caagagtgcctgctggccgaggccgagggacgccccctgcgggaacctggatcctcacac
ctcgggagcccggacactgcgaggaagaagccaaagctgaagcctggaaagtcactgccg
ctcggtgtggaagagttggggcagctgccgcttgctgagggccgccctctccgcaagtcc
tttcgtagagagatgccgggtggagctgtgaattcggccctgcgacgagagtctcaggga
tccctgaattcttccgcgagtctggacctgggcttccttgcctttgtgagcagcaaatcc
gagagccaccgaaagagccttggaagtggagagggtgagagcgaaagccggcccgggaag
tactgctgcgtgtatctacctgatggcacggcctccttggccctggctcgacctggcctc
accatccgtgacatgctggcaggcatctgtgagaagagaggcctctctctacctgacatt
aaggtctacctggtgggcaaagaacagaaggccctggtcctggatcaggactgcaccgtg
ctggcagaccaggaagtgcgactggaaaacaggatcaccttccagctggagttggtcggc
ctggagcgtgtggtacggatctctgctaagcccaccaagcgtctgcaggaggcgctgcag
cctatcttggccaagcacggcctgagcctggatcaggtggtcctacacaggccaggagag
aagcagctagtggatttggagaatctagtgagctcagtggcttcacagacactggttttg
gacactcttccagatgcaaagacaagggaagccagcagcatacctccctgccgcagccag
ggatgcctccctagaacccagaccaaggacagtcaccttcctccactgtcctccagtttg
tcggtagaagatgccagtggttctactgggaaacgacagacctgcgacattgaaggccta
gtggagctgctgaatcgtgtgcagagcagcggggcccatgaccagaggggacttcttcgc
aaagaggacctggtccttccagaatttctgcagcttccttcccaaagaccaggttctcag
gaggctccaccatag

DBGET integrated database retrieval system