KEGG   Rattus norvegicus (rat): 114711
Entry
114711            CDS       T01003                                 

Gene name
Gne, Uae1
Definition
(RefSeq) glucosamine (UDP-N-acetyl)-2-epimerase/N-acetylmannosamine kinase
  KO
K12409  bifunctional UDP-N-acetylglucosamine 2-epimerase / N-acetylmannosamine kinase [EC:3.2.1.183 2.7.1.60]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00520  Amino sugar and nucleotide sugar metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    114711 (Gne)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.60  N-acylmannosamine kinase
     114711 (Gne)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.183  UDP-N-acetylglucosamine 2-epimerase (hydrolysing)
     114711 (Gne)
SSDB
Motif
Pfam: Epimerase_2 ROK Hexokinase_1 DRTGG FGGY_N Glucokinase
Other DBs
NCBI-GeneID: 114711
NCBI-ProteinID: NP_446217
RGD: 69239
Ensembl: ENSRNOG00000014365
UniProt: O35826
Position
5q22
AA seq 722 aa
MEKNGNNRKLRVCVATCNRADYSKLAPIMFGIKTEPAFFELDVVVLGSHLIDDYGNTYRM
IEQDDFDINTRLHTIVRGEDEAAMVESVGLALVKLPDVLNRLKPDIMIVHGDRFDALALA
TSAALMNIRILHIEGGEVSGTIDDSIRHAITKLAHYHVCCTRSAEQHLISMCEDHDRILL
AGCPSYDKLLSAKNKDYMSIIRMWLGDDVKCKDYIVALQHPVTTDIKHSIKMFELTLDAL
ISFNKRTLVLFPNIDAGSKEMVRVMRKKGIEHHPNFRAVKHVPFDQFIQLVAHAGCMIGN
SSCGVREVGAFGTPVINLGTRQIGRETGENVLHVRDADTQDKILQALHLQFGKQYPCSKI
YGDGNAVPRILKFLKSIDLQEPLQKKFCFPPVKENISQDIDHILETLSALAVDLGGTNLR
VAIVSMKGEIVKKYTQFNPKTYEERISLILQMCVEAAAEAVKLNCRILGVGISTGGRVNP
QEGVVLHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNCAAMAERKFGQGKGQENFVTL
ITGTGIGGGIIHQHELIHGSSFCAAELGHLVVSLDGPDCSCGSHGCIEAYASGMALQREA
KKLHDEDLLLVEGMSVPKDEAVGALHLIQAAKLGNVKAQSILRTAGTALGLGVVNILHTM
NPSLVILSGVLASHYIHIVRDVIRQQALSSVQDVDVVVSDLVDPALLGAASMVLDYTTRR
IH
NT seq 2169 nt   +upstreamnt  +downstreamnt
atggagaagaacgggaataaccggaagcttcgggtttgcgttgccacctgcaaccgagcc
gattactccaaactggcccccatcatgttcggcattaagacggagcctgcgttcttcgag
ctcgacgtggtggtgctgggctctcacctgatcgacgactacggaaacacataccgcatg
attgagcaggacgactttgacatcaacaccaggctacacacgattgttagaggggaagac
gaagcagccatggtagagtcagtgggcctagcgctagtgaagctaccggatgtcctcaac
cgcctgaagcctgacatcatgattgttcacggagaccgatttgacgccctcgctctggct
acatctgctgccctgatgaacatccgcatccttcacattgaaggaggagaggtcagcggg
actattgatgactctatcagacacgccataacaaaactggctcactaccacgtgtgctgc
accaggagtgcagagcaacacctgatctccatgtgtgaggaccacgaccgcatccttttg
gctggctgcccttcctatgacaaactgctctcagccaagaataaagactatatgagcatc
attcggatgtggctaggtgatgatgtaaaatgtaaagattacattgttgccctgcaacac
ccggtgaccaccgacattaagcattccataaagatgttcgaactgacactggatgctctt
atctcatttaacaagaggaccctagttctgtttccaaatatcgatgcaggcagcaaggag
atggttcgagtgatgcggaagaagggcatcgagcatcaccccaatttccgcgcagtcaag
cacgtcccgtttgaccagttcattcagctggtcgcccacgctggctgcatgattgggaat
agcagctgtggagtgcgtgaggttggcgcctttggaacccctgtgatcaacctgggcacg
cggcagataggaagagaaacgggggagaatgttcttcatgtccgggatgctgacacccaa
gacaaaatattacaagcactacacctccagttcggtaaacagtacccttgctcaaagata
tatggggatggaaatgctgttccaaggattttaaagtttctcaaatccatcgaccttcaa
gagccactacagaagaaattctgcttccctcccgtgaaggagaacatctctcaggatatt
gaccatatcctcgaaactctgagtgccttggctgttgatctcggggggacgaatctgaga
gtggcgatagttagcatgaagggtgaaatagttaagaagtacacccagttcaatcctaaa
acctatgaggaaaggattagtctaatcctgcagatgtgtgtggaagcggcagcagaagcc
gtgaagctcaattgcagaattctgggagtaggcatctccacaggtggccgtgtgaatccc
caggaaggagttgtgctgcactcgaccaagctgatacaggagtggaactctgtggacctc
aggacaccactctccgacaccctgcatctccccgtgtgggtggacaacgacggcaactgc
gctgccatggcggagaggaagtttggccaaggaaaaggacaggagaactttgtgacgctc
atcacagggacagggatcggtgggggaatcatccaccagcacgagctgatccacggcagc
tccttctgtgcggcagagcttggccacctcgtggtgtctctggatggtcctgactgctcc
tgtggaagccatgggtgcattgaagcctacgcctctggaatggccttgcagagggaagca
aagaagctccacgacgaggacctgctcttggtggaagggatgtcagtgccaaaagacgaa
gctgtgggcgccctccatctcatccaagccgccaagctgggcaacgtgaaggcccagagc
atcttacggacagctggaactgctttgggactcggagttgtgaatatcctccacactatg
aatccttccctggtgatcctgtctggagtcctggctagtcactacatccacattgtgagg
gacgtcatccgccagcaagccctgtcctccgtgcaggatgtggatgtagtggtttcagac
ttggttgacccggccctgcttggtgcggccagcatggttctggactacacgacccgcagg
atccactag

DBGET integrated database retrieval system