KEGG   Rattus norvegicus (rat): 114845
Entry
114845            CDS       T01003                                 

Gene name
Klf3, Bklf, Tef-2
Definition
(RefSeq) Kruppel like factor 3
  KO
K15605  krueppel-like factor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    114845 (Klf3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    114845 (Klf3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    114845 (Klf3)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-H2C2_5
Other DBs
NCBI-GeneID: 114845
NCBI-ProteinID: NP_001099212
RGD: 1593290
Ensembl: ENSRNOG00000002163
UniProt: D4A4V3
Position
14p11
AA seq 344 aa
MLMFDPVPVKQEAMDPVTVSYPSNYIESMKPNKYGVIYSTPLPDKFFQTPEGLAHGIQME
PVDLTVNKRGSPPSAAGSPSSLKFPSHRRASPGLSMPSSSPPIKKYSPPSPGVQPFGVPL
SMPPVMAAALTRHGIRSPGILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMDNSNSGMP
VPVIESYEKPILQKKIKIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQENHPSVIVQP
GKRPLPVESPDTQRKRRIHRCDYDGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWKF
ARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgctcatgtttgacccagtccctgtcaagcaagaggccatggaccccgtcacggtgtcc
tacccatcaaattacatagaatcaatgaagcccaacaaatatggggtcatttactctaca
ccattacctgacaagttcttccagaccccagaaggcctcgctcacgggatacagatggag
cctgtggacctcactgtgaacaagcggggctccccgccttctgctgctggttctccttcc
tctctgaaatttccatcacaccggagagcatcaccggggctcagcatgccttcctccagc
ccacccattaagaaatactcacccccctctcctggtgtgcaacccttcggagtaccactg
tccatgccacctgtgatggccgctgcactgaccagacatgggatccggagcccgggcatc
ctccctgtcatccagcccgtcgtggtacaacctgtccccttcatgtacaccagccacctg
cagcagcctctcatggtctccttgtcagaagaaatggacaattcaaacagcggcatgcca
gtacccgtaattgaatcctatgagaagcccatattacagaaaaaaattaaaatagaacct
ggaatcgaaccacagaggactgactattaccctgaagaaatgtcaccccctttaatgaac
tcagtgtcccccccgcaagcgttgttgcaagagaaccacccttccgtcattgtgcagccc
gggaagagacctctacctgtggaatccccggatacccaaaggaagcgcaggatacacaga
tgcgactatgatggatgcaataaggtctacactaagagctcgcacttgaaagcacacaga
agaacccatacaggggaaaagccgtacaaatgcacctgggaaggctgcacgtggaagttt
gctcggtctgatgaactgacgagacatttccgaaaacacactggaatcaaacctttccag
tgtccagactgtgaccgaagcttctctcgctccgaccaccttgccctacataggaaacgc
cacatgctagtctga

DBGET integrated database retrieval system