KEGG   Rattus norvegicus (rat): 114850
Entry
114850            CDS       T01003                                 

Gene name
Wnt7a
Definition
(RefSeq) wingless-type MMTV integration site family, member 7A
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114850 (Wnt7a)
   04390 Hippo signaling pathway
    114850 (Wnt7a)
   04150 mTOR signaling pathway
    114850 (Wnt7a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    114850 (Wnt7a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    114850 (Wnt7a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114850 (Wnt7a)
   05205 Proteoglycans in cancer
    114850 (Wnt7a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    114850 (Wnt7a)
   05226 Gastric cancer
    114850 (Wnt7a)
   05217 Basal cell carcinoma
    114850 (Wnt7a)
   05224 Breast cancer
    114850 (Wnt7a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114850 (Wnt7a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    114850 (Wnt7a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    114850 (Wnt7a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    114850 (Wnt7a)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Morphogens
   114850 (Wnt7a)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 114850
NCBI-ProteinID: NP_001093943
RGD: 69079
Ensembl: ENSRNOG00000048782
UniProt: M0R9D3
Position
4q34
AA seq 349 aa
MTRKARRCLGHLFLSLGIVYLRIGDFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgacccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatagtctat
ctccggatcggtgacttctcttcggttgtggctctgggtgcgagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcaatctgccagagtcggccggacgccatcatc
gtcataggagaaggctcccaaatgggcctggacgagtgtcagtttcagttccgcaatggc
cgttggaactgttcagcgctgggagagcgcactgtcttcgggaaggagctcaaagtgggg
agtcgggaggccgccttcacctatgcaattattgctgcgggtgtggcccatgccatcacc
gctgcctgcacccaaggcaacctgagtgactgtggctgcgacaaggagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtcttcgtggatgcccgagagatcaagcagaatgcccgaaccctcatg
aacttacacaataacgaggcaggccggaagatcctggaggagaacatgaaactggagtgt
aagtgccatggcgtgtcaggatcctgtaccactaagacgtgctggaccacactgccacaa
ttccgagagctaggctacgtgctcaaggacaaatacaacgaggccgtccatgtggaacct
gtccgtgccagtcggaacaagcggcccacctttctgaagatcaagaagcccctgtcctac
cgtaagcccatggacactgatctggtgtacatcgagaagtcacccaattactgtgaagag
gacccagtgacaggcagcgtgggcacacagggccgtgcctgcaataagacagcccctcag
gctagtggctgtgacctcatgtgctgcggccgtggctacaacacacaccagtatgcccgg
gtgtggcagtgcaactgcaaattccactggtgctgctacgtcaagtgtaacacatgcagc
gagcgcacagagatgtatacgtgcaagtga

DBGET integrated database retrieval system