KEGG   Rattus norvegicus (rat): 114856Help
Entry
114856            CDS       T01003                                 

Gene name
Dusp1, 3CH134, CL100, MKP-1, Mkp1, Ptpn16
Definition
(RefSeq) dual specificity phosphatase 1
  KO
K21278  dual specificity protein phosphatase 1 [EC:3.1.3.16 3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04726  Serotonergic synapse
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114856 (Dusp1)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    114856 (Dusp1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    114856 (Dusp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    114856 (Dusp1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     114856 (Dusp1)
    3.1.3.48  protein-tyrosine-phosphatase
     114856 (Dusp1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    114856 (Dusp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese Y_phosphatase Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 114856
NCBI-ProteinID: NP_446221
RGD: 620897
Ensembl: ENSRNOG00000003977
UniProt: Q64623 Q63683
Position
10q12
AA seq 367 aa AA seqDB search
MVMEVGILDAGGLRALLRERAAQCLLLDCRSFFAFNAGHIVGSVNVRFSTIVRRRAKGAM
GLEHIVPNTELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARSTQVFF
LQGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILSF
LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA
IDFIDSIKDAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS
FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHPTNSALNYLQSP
ITTSPSC
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtgatggaggtgggcatcctggacgccggggggctgcgcgcgctgctgcgagagcgc
gccgctcagtgcctgcttctggattgtcgctccttcttcgccttcaacgccggccacatc
gtgggctcagtgaacgtgcgcttcagcaccatcgtgcggcgccgcgccaagggcgccatg
ggcctggagcatatcgtgccgaacaccgaactgcgcggccgcctgctggccggagcctat
cacgccgtagtgctgctggacgaacgcagcgccgccctggacggcgccaagcgcgacggc
accctggccctggccgcgggcgcgctctgccgagaagcgcgctccactcaagtcttcttc
ctccaaggaggatatgaagcgttttcggcttcctgccctgagctgtgcagcaaacagtcc
acccccatggggctcagcctcccgctgagtactagtgtgcctgacagtgcagaatccgga
tgcagctcctgtagcacccctctctacgaccaggggggcccagtggagatcctgtccttc
ctgtacctgggcagtgcttaccatgcttcccggaaagatatgctcgacgccttgggtatc
actgctttgatcaacgtctcggccaattgtcctaaccactttgagggtcactaccagtac
aagagcatccctgtggaggacaaccacaaggcagacattagctcctggttcaacgaggcg
attgactttatagactccatcaaggatgctggaggaagggtgtttgtgcactgccaggcc
ggcatctccaggtcagccaccatctgccttgcttacctcatgaggactaaccgagtgaag
ctggacgaggcctttgagttcgtgaagcagaggcggagtattatctcccccaacttcagc
ttcatgggccagctgctgcaatttgagtcccaagtactggcccctcactgttctgcagaa
gctgggagcccggccatggctgtccttgaccggggcacctctactacaacggtcttcaac
ttccctgtctccatccctgttcaccccacgaacagtgccctgaactaccttcaaagcccc
atcacaacctctccgagctgctga

DBGET integrated database retrieval system