KEGG   Rattus norvegicus (rat): 114858
Entry
114858            CDS       T01003                                 

Gene name
Shc3
Definition
(RefSeq) SHC-transforming protein 3
  KO
K17448  SHC-transforming protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04510  Focal adhesion
rno04650  Natural killer cell mediated cytotoxicity
rno04722  Neurotrophin signaling pathway
rno04910  Insulin signaling pathway
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04926  Relaxin signaling pathway
rno04935  Growth hormone synthesis, secretion and action
rno05034  Alcoholism
rno05100  Bacterial invasion of epithelial cells
rno05214  Glioma
rno05220  Chronic myeloid leukemia
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114858 (Shc3)
   04014 Ras signaling pathway
    114858 (Shc3)
   04072 Phospholipase D signaling pathway
    114858 (Shc3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114858 (Shc3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    114858 (Shc3)
   04062 Chemokine signaling pathway
    114858 (Shc3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    114858 (Shc3)
   04915 Estrogen signaling pathway
    114858 (Shc3)
   04917 Prolactin signaling pathway
    114858 (Shc3)
   04926 Relaxin signaling pathway
    114858 (Shc3)
   04935 Growth hormone synthesis, secretion and action
    114858 (Shc3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    114858 (Shc3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    114858 (Shc3)
   05226 Gastric cancer
    114858 (Shc3)
   05214 Glioma
    114858 (Shc3)
   05220 Chronic myeloid leukemia
    114858 (Shc3)
   05224 Breast cancer
    114858 (Shc3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    114858 (Shc3)
  09165 Substance dependence
   05034 Alcoholism
    114858 (Shc3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    114858 (Shc3)
   01522 Endocrine resistance
    114858 (Shc3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 114858
NCBI-ProteinID: NP_001099213
RGD: 69348
Ensembl: ENSRNOG00000014366
UniProt: G3V7V0
Position
17
AA seq 594 aa
MLPRTKYNRFRNDSVTSVDDLLHSLSVSGSGGKVSAEPAASPYLVSGEALRKAPDDGPGS
LGHLLHKVSHLKLSSSGLRGLSSAARERAGARLSGSCSAPSLAAPDGGSATPGSRAPAAS
MSATRKSRASDEPLPRPPRGAPHASDQVLGSGVTYVVKYLGCIEVLRSMRSLDFSTRTQV
TREAISRVCEAVPGAKGAFKKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPD
SKQIIANHHMRSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQA
FELRFKQYLQCPSKIPALQDRMQSLDEPWTEEEGDGPDHPYYNSVPNKMPPPGGFLDARL
KARPHAPDAAQFSGKEQTYYQGRHLGDAFGEDWQRAPTRQGSLDIYSTPEGKAHMVPVGE
TPTYVNTQPVPPQVWPAATSSTESSPRKDLFDMKPFEDALRNQPLGPVLSKAASVECISP
VTPRAPDAKMLEELNAEPWYQGEMSRKEAEALLQEDGDFLVRKSTTNPGSFVLTGMHNGQ
AKHLLLVDPEGTVRTKDRVFDSISHLITYHLESSLPIVSAGSELCLRQPVERKP
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgcttccacgcaccaagtacaaccgcttcaggaatgactcggtgacatcggtcgatgac
cttctccacagcctgtcggtgagcggcagcggcggcaaggtctcggcggagcccgcggcg
agcccctacctggtgtcgggcgaggcgctgcgcaaggcgccggacgatgggcccggcagc
ctgggccacctgctccacaaggtgtcccacttgaaactctccagctccggcctgcgtggc
ctgtcgtcggccgcccgggagcgggcaggagcgcggctctcgggcagctgcagcgcgccc
agcctggcggccccggacggtggcagcgcgacccccgggtcccgtgccccggccgccagc
atgagcgccaccaggaagagccgggccagcgacgagccgttgcccaggcccccgcggggc
gcgccgcacgccagcgaccaggtgctggggtcgggagtcacctatgtggtcaagtacttg
ggatgcatcgaagttctgcgctcaatgaggtctcttgacttcagtacaagaactcaggtt
accagggaagccatcagccgtgtctgcgaagctgtgccaggcgccaaaggagccttcaag
aagagaaagcctccgagtaaaatgctgtccagcatcctggggaagagcaacctccagttc
gcagggatgagcatctccctgaccatctccaccgccagcctgaacctgcgcactcctgac
tccaaacagatcatagcgaaccatcacatgcggtccatctccttcgcctcagggggagac
ccggacacaacagactatgttgcctacgtcgctaaggaccctgtgaatcgcagagcttgc
cacattctggaatgctgtgacgggctagcccaagatgtcatcggctccatcggacaagcc
tttgaactccggttcaagcagtatttgcagtgtccttccaagattcctgctctccaggac
cgaatgcagagtctggacgagccgtggactgaagaagagggagatggccccgatcacccg
tactacaacagcgttcccaacaagatgcctcctccaggagggtttctcgatgctcgattg
aaagccagaccccacgctcctgatgcagcccagttttcaggaaaagagcaaacttattac
cagggaagacacttaggagatgcattcggtgaagactggcagagagcacccaccaggcaa
ggctccttggacatctatagcacaccagaagggaaagctcacatggttcctgtaggagaa
acaccaacctatgtcaacacccagccagtcccaccacaggtttggccagcagcaaccagc
agcactgagagcagcccacggaaggacctctttgacatgaagccttttgaagatgccctc
agaaaccaacccctgggccctgtgttgagcaaagctgcgtctgtggagtgtatcagcccc
gttacacccagagccccggacgccaagatgctggaggagcttaatgctgagccctggtac
caaggcgagatgagcaggaaggaggcagaggctctactacaggaagatggagacttccta
gtcaggaagagtaccaccaaccccggctcctttgtcctcacaggcatgcacaatggccag
gccaagcacctgctgctggtggacccggaaggcacggtccggacgaaggacagggtcttt
gacagcatcagtcacctcattacttaccacctggagagcagcctgcccattgtctctgcc
gggagtgagctttgtctccggcaaccagtggagaggaaaccctga

KEGG   Rattus norvegicus (rat): 314612
Entry
314612            CDS       T01003                                 

Gene name
Shc2
Definition
(RefSeq) SHC-transforming protein 2
  KO
K17447  SHC-transforming protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04370  VEGF signaling pathway
rno04510  Focal adhesion
rno04650  Natural killer cell mediated cytotoxicity
rno04722  Neurotrophin signaling pathway
rno04910  Insulin signaling pathway
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04926  Relaxin signaling pathway
rno04935  Growth hormone synthesis, secretion and action
rno05034  Alcoholism
rno05100  Bacterial invasion of epithelial cells
rno05214  Glioma
rno05220  Chronic myeloid leukemia
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    314612 (Shc2)
   04014 Ras signaling pathway
    314612 (Shc2)
   04370 VEGF signaling pathway
    314612 (Shc2)
   04072 Phospholipase D signaling pathway
    314612 (Shc2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    314612 (Shc2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    314612 (Shc2)
   04062 Chemokine signaling pathway
    314612 (Shc2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    314612 (Shc2)
   04915 Estrogen signaling pathway
    314612 (Shc2)
   04917 Prolactin signaling pathway
    314612 (Shc2)
   04926 Relaxin signaling pathway
    314612 (Shc2)
   04935 Growth hormone synthesis, secretion and action
    314612 (Shc2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    314612 (Shc2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    314612 (Shc2)
   05226 Gastric cancer
    314612 (Shc2)
   05214 Glioma
    314612 (Shc2)
   05220 Chronic myeloid leukemia
    314612 (Shc2)
   05224 Breast cancer
    314612 (Shc2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    314612 (Shc2)
  09165 Substance dependence
   05034 Alcoholism
    314612 (Shc2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    314612 (Shc2)
   01522 Endocrine resistance
    314612 (Shc2)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 314612
NCBI-ProteinID: NP_001101535
RGD: 1307137
Ensembl: ENSRNOG00000008030
UniProt: O70142
Position
7
AA seq 573 aa
MTQGPGGRAAPEPEAPTTFCALLPRMPQWKFAAPGSFLGRGPAAARVAGAAEAQPEPGVP
ALAAVLGACEPRCAAPCPLPALGRCRGSGSRGARGTPDVADEWVRKGGFIHKPAHGWLHP
DARVLGPGVSYIVRYMGCIEVLRSMRSLDFNTRTQVTREAINRLHEAVPGVRGSWKKKAP
NKALASILGKSNLRFAGMSISVNISVDGLNLSVPATRQIIANHHMQSISFASGGDTDMTD
YVAYVAKDPINQRACHILECCEGLAQSVISTVGQAFELRFKQYLHSPPKAVVPPERLTGL
EESAWGDGEVTADHDYYNSIPGKEPPLGGLVDSRLAVTQPCALTTLGGLGQGLSPAWRDV
RGLPWDMGPSGAVPPGDGYVQADARGPHDYEEHLYVNTQGLDALELEDTSETPLQPEDSP
KKDLFDMRPFEDALKLHECSVAAGITAASLPLEDQWPSPPTRRAPIAPTEEQLRQEPWYH
GRMSRRAAEKLLRADGDFLVRDSITNPGQYVLTGMHAGQPKHLLLVDPEGVVRTKDVLFE
SISHLIDYHLKNGLPIVAAESELHLRGVVSREP
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgacgcagggtcccggtggccgcgcggcccccgagcccgaggcgcccaccaccttctgc
gcgctgctaccgcgcatgccgcagtggaagttcgcggcgcccggtagcttcctgggccgc
ggtccggcggctgcgcgcgtggcgggggcggcagaggcgcagcccgagcctggggtcccc
gcgctggccgccgtgctgggtgcctgcgaaccgcgctgtgccgcgccctgtccgctacca
gctctcggccgctgccggggctcggggtcgcggggcgcgcggggaactcccgacgtcgcc
gacgagtgggtgcgcaagggcggcttcattcacaagcccgcgcacggctggctgcacccc
gatgcgagggtcctggggcccggggtctcttacatcgttcggtacatgggctgcattgag
gtgctccgatctatgcgctccctggatttcaacacccggacacaggtgacgagggaagcc
atcaatcggctccacgaggctgtgccaggtgtccgaggctcctggaagaagaaggccccc
aacaaggcgctggcctccatcttggggaaaagcaacctgcgcttcgccggcatgagcatc
tcagtcaacatctctgtggacggccttaacttgtcagttcccgctacccgtcagatcatc
gccaaccatcacatgcagtctatttccttcgcctccggtggcgacacggacatgaccgat
tacgtggcctatgtggccaaggaccccatcaaccagagagcctgccacatcttggaatgc
tgtgagggtctcgcccagagtgtcatcagcaccgtggggcaagcctttgagctgcgcttc
aagcaatacctgcacagtccgcccaaggctgtcgtgccccctgaaaggctgaccgggctg
gaggagtcggcctggggtgatggtgaggttactgcagaccacgattactacaacagcatt
ccaggaaaggagccacccctgggcgggctggtggactccagactggctgtcacacagccc
tgtgcgctgacaacacttgggggccttggacagggattgtcacctgcctggagagatgtc
cgtggcttgccttgggacatgggcccctctggagcagtcccacctggggatggctacgtg
caggcagatgcccgagggccacatgactacgaggaacacctgtatgtcaacacccagggc
ctggacgctttggagcttgaggacacctccgagacacctctgcagcctgaggacagcccc
aagaaggacctgtttgacatgcgaccctttgaagatgccctgaagttgcacgagtgctcc
gtggcagcaggcattactgcagcctcactccctctggaggatcagtggcccagcccccct
acccgcagggcccccattgcacccacagaggagcaactgaggcaggagccctggtaccat
ggacgaatgagccgtcgggctgcagagaagctgcttcgtgccgatggggacttccttgtg
agagacagcatcaccaacccggggcagtatgtcctcacaggcatgcacgcggggcagccc
aagcacctgctgctggtggaccccgagggtgtggtacggacaaaagatgtgctgtttgag
agcatcagccacctcatagactatcacctgaagaacgggttgcccatcgtggctgccgag
agtgaactgcatctgcggggagtggtctctcgggagccatga

KEGG   Rattus norvegicus (rat): 679845
Entry
679845            CDS       T01003                                 

Gene name
Shc4
Definition
(RefSeq) SHC-transforming protein 4
  KO
K17449  SHC-transforming protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04510  Focal adhesion
rno04650  Natural killer cell mediated cytotoxicity
rno04722  Neurotrophin signaling pathway
rno04910  Insulin signaling pathway
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04926  Relaxin signaling pathway
rno04935  Growth hormone synthesis, secretion and action
rno05034  Alcoholism
rno05100  Bacterial invasion of epithelial cells
rno05206  MicroRNAs in cancer
rno05214  Glioma
rno05220  Chronic myeloid leukemia
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    679845 (Shc4)
   04014 Ras signaling pathway
    679845 (Shc4)
   04072 Phospholipase D signaling pathway
    679845 (Shc4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    679845 (Shc4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    679845 (Shc4)
   04062 Chemokine signaling pathway
    679845 (Shc4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    679845 (Shc4)
   04915 Estrogen signaling pathway
    679845 (Shc4)
   04917 Prolactin signaling pathway
    679845 (Shc4)
   04926 Relaxin signaling pathway
    679845 (Shc4)
   04935 Growth hormone synthesis, secretion and action
    679845 (Shc4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    679845 (Shc4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    679845 (Shc4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    679845 (Shc4)
   05226 Gastric cancer
    679845 (Shc4)
   05214 Glioma
    679845 (Shc4)
   05220 Chronic myeloid leukemia
    679845 (Shc4)
   05224 Breast cancer
    679845 (Shc4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    679845 (Shc4)
  09165 Substance dependence
   05034 Alcoholism
    679845 (Shc4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    679845 (Shc4)
   01522 Endocrine resistance
    679845 (Shc4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 679845
NCBI-ProteinID: NP_001177994
RGD: 1583644
Ensembl: ENSRNOG00000037134
UniProt: D4A3K2
Position
3
AA seq 622 aa
MRERSQDSQAGLTLYVGLFGHLGMLHRTKYSRFRNESITSLDEGSPGGSVGNKGSSPPPY
AALTPHLPAEDATVPNQESPTALCTLIPRMASMKLANPVTFLSLKTFCLGSKQVPRLKLQ
ENQDQTPSSPASPETSLNSTGPAPTPLPDQVGCRPTSLRPDTCPLPGPGEPNPRSKQDGP
PLQHLLGNGLNYCVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGVHGAIKKRK
APVKFLTTVLGKSNLQFSGMNIKLTVSTSSLTLMNLDNQQIIANHQMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECRSGTAQDIISTIGQAFELRFKQYLKNPSLNTWEREEVL
VDGTSEDRGHDYYNSIPGKQPPAGGIADVRIQVQADPVAYCPIRCEKLCYLPGTSTCSGV
YKNCMGRSRPIGIPHERAMQSDAASLRHFWRVDLFDDPCYVNTQNMRGCAGNQSSTLPQG
SPWHLGKAPETVQPGATAKPGSSHALPHIKQQLWSEECFHGRLSRGAAERLLVKDGDFLV
RESVTSPGQFVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIKYHMDNSLPIISSG
SEVSLKQPVKKHNNPGLSHSKK
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgcgagaacgcagccaggacagccaggcaggactcacgctgtatgtaggactctttggg
cacctggggatgcttcacaggaccaagtacagccgctttcggaacgagtccatcacgtct
ttggacgaagggagccccggaggctcggttggaaacaagggctcatcgccacctccttac
gcagccctgacccctcacctgcctgctgaagatgccactgtgcccaaccaggagagcccc
accgcgctgtgcaccttgattccccgtatggcaagcatgaagctggccaaccccgtcact
tttctgagtctgaaaaccttctgcctgggttcgaaacaggtgcccaggctgaagctccaa
gagaaccaggatcagactccaagcagcccagcgtccccagaaaccagtctgaatagtact
gggcctgcacctacacctcttccggaccaggtgggatgcaggcccacctccttgcgtcct
gatacttgcccactgcctgggcctggagaaccaaaccctaggagcaagcaggatggacct
cctctgcagcacctgttggggaacggtctcaactactgtgtgaggtacatgggctgcatt
gaagtgctgcagtcaatgaggtcactggattttggaatgagaacccaagttacaagggaa
gcaataagtcgcctgtgtgaagctgtccctggggtccatggagccattaaaaaacgaaag
gctcccgttaagttcctgacaacggttcttggcaaaagcaatcttcagttttcaggaatg
aatataaaactgactgtttcaacaagcagcctcacgctgatgaaccttgacaaccaacag
attattgcaaatcatcaaatgcaatcgatttcctttgcctctggaggggatcctgatacc
acagactatgttgcctatgtagctaaagatccagtcaaccaacgagcgtgccacatcctg
gagtgtcgcagtggaacggcccaagatatcataagcaccatagggcaggcctttgagctc
cggttcaaacagtacttgaagaatccttccttgaacacttgggaaagggaggaggtcctt
gttgatggcacctctgaagacagaggccacgactattacaactccatcccagggaagcag
ccccctgcaggcggcattgcagatgtgcggatccaggttcaagcagatccagtggcttac
tgccctatccggtgtgagaagttgtgctatttgcccgggacctccacgtgcagcggcgtg
tacaagaactgcatgggacggagcaggccaatcggtattccccacgagagagcgatgcag
agtgacgctgcatcgctgaggcacttctggcgagtggatctctttgatgacccctgctat
gtcaatacacagaatatgcgcggctgtgctggaaatcaaagctcaactctgccacaaggg
agcccatggcaccttggaaaggcaccagagaccgtgcagccaggagccaccgccaagcct
gggagctcacacgctttgccacacattaagcagcaactgtggagtgaggaatgcttccac
ggcaggctgagcaggggggcagcggagagacttttggtgaaggatggggactttttggtt
cgagagagtgtgacatctcctggccagtttgtactgagcggactgcaaggcggccaggcc
aagcatcttctcttggtggatcctgaaggcaaggtgaggaccaaggaccatgtgtttgat
aatgttggccacctgatcaaataccacatggataatagtttgccaatcatctcttctgga
agtgaagtaagccttaaacaaccagtaaaaaaacataataacccaggactttcgcactcg
aagaaatga

KEGG   Rattus norvegicus (rat): 85385
Entry
85385             CDS       T01003                                 

Gene name
Shc1
Definition
(RefSeq) SHC-transforming protein 1 isoform b
  KO
K06279  SHC-transforming protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04510  Focal adhesion
rno04650  Natural killer cell mediated cytotoxicity
rno04722  Neurotrophin signaling pathway
rno04910  Insulin signaling pathway
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04926  Relaxin signaling pathway
rno04935  Growth hormone synthesis, secretion and action
rno05034  Alcoholism
rno05100  Bacterial invasion of epithelial cells
rno05206  MicroRNAs in cancer
rno05214  Glioma
rno05220  Chronic myeloid leukemia
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    85385 (Shc1)
   04014 Ras signaling pathway
    85385 (Shc1)
   04072 Phospholipase D signaling pathway
    85385 (Shc1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    85385 (Shc1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    85385 (Shc1)
   04062 Chemokine signaling pathway
    85385 (Shc1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    85385 (Shc1)
   04915 Estrogen signaling pathway
    85385 (Shc1)
   04917 Prolactin signaling pathway
    85385 (Shc1)
   04926 Relaxin signaling pathway
    85385 (Shc1)
   04935 Growth hormone synthesis, secretion and action
    85385 (Shc1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    85385 (Shc1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    85385 (Shc1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    85385 (Shc1)
   05226 Gastric cancer
    85385 (Shc1)
   05214 Glioma
    85385 (Shc1)
   05220 Chronic myeloid leukemia
    85385 (Shc1)
   05224 Breast cancer
    85385 (Shc1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    85385 (Shc1)
  09165 Substance dependence
   05034 Alcoholism
    85385 (Shc1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    85385 (Shc1)
   01522 Endocrine resistance
    85385 (Shc1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 85385
NCBI-ProteinID: NP_445969
RGD: 620446
Ensembl: ENSRNOG00000020657
UniProt: Q5M824 F1LN14
Position
2
AA seq 469 aa
MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCV
EVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGAMRRRKPCSRPLSSILGRSNLKFAGM
PITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHIL
ECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYY
NDFPGKEPPLGGVVDMRLREGAARPTLPSTQMPSHLGATLPIGQHVTGDHEVRKQMLPPP
PCPGRELFDDPSYVNIQNLDKARQAGGGAGPPNPSVNGSAPRDLFDMKPFEDALRVPPAP
QSMSMAEQLQGESWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLL
LVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVDRKV
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgaacaagctgagtggaggcggcgggcgcaggactcgggtagaagggggccagctgggg
ggcgaggagtggaccagacacgggagctttgtcaataagcccacacgaggctggctgcat
cccaacgacaaagtcatgggacctggggtttcctacttggttcggtacatgggttgcgtg
gaggtcttacagtcaatgcgagcccttgacttcaatacccggactcaggtcaccagggag
gctatcagtttggtgtgtgaagctgtgcctggtgccaaaggggcgatgaggaggagaaag
ccctgcagccgcccactcagctctatcctgggaaggagtaacctgaagtttgctggaatg
ccgatcactctcactgtgtctaccagcagccttaacctcatggcagcagactgcaaacag
atcattgccaaccatcacatgcaatctatctcattcgcgtctggtggggatccggacaca
gctgagtacgttgcctatgttgccaaagaccctgtgaatcagagagcctgccatatcctg
gagtgtcctgaaggacttgctcaggacgtcatcagcaccatcgggcaggcctttgagttg
cgcttcaaacagtatctcaggaatccacccaagctggtcaccccccatgacaggatggct
ggctttgatggctcagcttgggatgaggaggaagaagagccccctgaccatcagtactac
aatgacttcccagggaaggaaccccctcttggtggagtggtagatatgaggcttcgggaa
ggggctgctcgacccactctgcccagtacccagatgcccagccacttgggagctacactg
ccaatagggcagcatgttacaggagaccatgaagtccgtaaacagatgctgcctccacca
ccgtgcccaggcagagaactcttcgatgatccttcctatgtcaacatccagaatctagac
aaggcccggcaagctggtggtggggctggacccccaaatccttctgttaatggcagtgca
ccccgagacctctttgacatgaagcccttcgaagatgcactccgggtgccgccagctccc
cagtccatgtccatggctgagcagctccaaggggagtcctggtttcatgggaaactcagc
cggcgggaggctgaggcgctgctgcagctcaacggtgacttcttggtgcgagagagtaca
accacacctggccagtacgtgctcactggtctgcagagtgggcagcccaagcacttgctt
ctggtggaccctgaaggtgtggttcggacaaaggatcaccgctttgagagtgtcagtcac
ctgatcagctaccacatggacaatcacttacccatcatctctgcaggcagtgagctgtgt
ctacagcaacctgtggatcgaaaagtgtga

DBGET integrated database retrieval system