KEGG   Rattus norvegicus (rat): 114859
Entry
114859            CDS       T01003                                 

Gene name
Eif2ak4
Definition
(RefSeq) eIF-2-alpha kinase GCN2
  KO
K16196  eukaryotic translation initiation factor 2-alpha kinase 4 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04141  Protein processing in endoplasmic reticulum
rno05160  Hepatitis C
rno05162  Measles
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114859 (Eif2ak4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114859 (Eif2ak4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    114859 (Eif2ak4)
   05162 Measles
    114859 (Eif2ak4)
   05168 Herpes simplex virus 1 infection
    114859 (Eif2ak4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    114859 (Eif2ak4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114859 (Eif2ak4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   114859 (Eif2ak4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RWD HGTP_anticodon2 tRNA-synt_His Kinase-like ABC1 APH
Other DBs
NCBI-GeneID: 114859
NCBI-ProteinID: NP_001099214
RGD: 1311439
Ensembl: ENSRNOG00000006027
Position
3
AA seq 1649 aa
MAGGRGAAGRGPAEPQESYSQRQDHELQALEAIYGSDFQDLRPDARGRVREPPEINLVLY
PQGLAGEEVYVQVELRVKCPPTYPDVVPEIELKNTKGLSNESVNLLKSHLEELAKKQCGE
VMIFELAHHVQSFLSEHNKPPPKSFHEEMLERQAQEKQQRLLEARQKEEQEQREILHEIQ
KRKEEIKEEKKRKEMAKQERLEITSLTNQDHASKRDPAGHRAAAILHGGSPDFVGNGKAR
AHSSGRSRRERQYSVCSGEASPGSCDILYFCVGSADQLMVHKGKCVGSDEQLGKVVYNAL
ETATGSFVLLYEWVLQWQKKMGPCLTSQEKEKIDKCKKQIQGAETEFSSLVKLSHPNIVR
YFAMNSREEKDSIVVDILAEHISGISLAAHLSHSGPVPMHQLRKYTAQLLAGLDYLHRNS
VVHKVLSTASVLVDAEGTVKITDYSISKRLADICKEDVFEQTRVRFSDSALPYKTGKKGD
VWRLGLLLLSLSQGQECEEYPVTIPSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFIN
PQPKMPLVEQSPEDSGGQDYIETIIPSNQLPSAAFFTETQRQFSRYFIEFEELQLLGKGA
FGAVIKVQNKLDGCCYAVKRIPINPASRQFRRIKGEVTLLSRLHHENIVRYYNAWIERHE
RPAVPGTPPPDYIPQAQNSSATGGKASGDTEELGSVEAAAPPPILSSSVEWSTSAERSNS
ARFPVTGQDSSSDEEDEDERDGVFSQSFLPASDSDSDIIFDNEDENSKSQNQDEDCNEKD
SRHEIEPSVTTEAVHYLYIQMEYCEKSTLRDTIDQGLFRDTSRLWRLFREILDGLAYIHE
KGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFNAEGKQDDQAGDHVIKSDPSGHLTG
MVGTALYVSPEVQGSTKSAYNQKVDLFSLGIILFEMSYHPMVTASERIFVLNQLRDPTSP
KFPDDFEDGEHTKQKSVISWLLNHDPAKRPTAMELLKSELLPPPQMEESELHEVLHHTLA
NTDGKAYRTMMSQLFCQHSSPAIDYTYDSDILKGNFLIRTAKIQQLVCETIVRVFKRHGA
VQLCTPLLLPRNRQIYEHNEAALFMDHSGMLVMLPFDLRVPFARYVARNNILNLKRYCIE
RVFRPRKLDRFHPKELLECAFDIVTSTANSSLPTAETIYTIYEVIQEFPALQERNYSIYL
NHTMLLKAILLHCGIPEDKLSQVYVILYDAVTEKLTRREVEAKFCNLSLSSNSLCRLYKF
IEQKGDLQDLTPTINSLIKQKTGIAQLVKYSLKDLEEVVGLLKKLGVKLQVSINLGLVYK
VQQHNGIIFQFLAFSKRRQRVVPEILAAGGRYDLLIPKFRGPQALGPVPTAVGVSIAIDK
IFAAVLNMGEPVTVSSCDLLVVSAGQMSMSRAINLTQKLWTAGITAEIMYDWSQSQEELQ
EYCRHHEITYVALVSDKEGSHVKVKSFEKERQTEKRVLESDLVDHVMQKLRTKVGDERNF
RDASDNLAVQTLKGSFSNASGLFEIHGTTVVPTVSVISPEKLSASTRRRHEIQVQTRLQT
TLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVC
DEIYNIKVEKKVSVLFLYSYRDDYYRILF
NT seq 4950 nt   +upstreamnt  +downstreamnt
atggctgggggccgcggggccgcaggacgcggcccggctgagccgcaggagagctattca
cagagacaggaccacgagctgcaggccctggaggcgatttacggctcggacttccaggat
ctgcggccggatgcgcgcggacgggtgagagagcctcctgaaatcaatttagttctgtac
cctcagggcctggctggtgaggaagtgtacgtgcaggtggagctgagggtcaaatgccca
ccgacatacccggatgtagttcccgaaatagagttaaaaaacactaaaggtctgtcgaat
gagagtgttaatttgttaaagtcacacctggaagaactggccaaaaagcagtgtggagag
gtgatgatattcgaactggcacaccacgtgcagtcgtttctcagcgagcataacaagccc
cctccaaagtctttccatgaagaaatgctggaaaggcaggctcaggagaagcagcagagg
ttgctggaggccaggcagaaagaggagcaggagcaacgtgaaatcctccacgagattcag
aaaaggaaagaggagatcaaggaagagaagaaaaggaaggaaatggctaagcaggaacgt
ttggaaattactagtttgacaaaccaggatcatgcctctaagagagacccagcaggacac
agggcagctgccattctccatggaggctctcctgactttgtaggaaatggtaaagcccgg
gcacactcctcaggaaggtccaggcgagaacgtcagtattctgtctgtagtggtgaagcc
tctcctggctcgtgtgacatcctctacttctgtgtgggtagcgctgatcagctcatggtg
cacaaagggaaatgtgttggcagcgatgagcagctggggaaggtggtatacaatgcattg
gaaacagccacgggcagctttgtcttgttgtatgagtgggtccttcagtggcagaaaaag
atgggcccttgccttaccagtcaagagaaagagaagatcgataaatgtaaaaagcagatt
caaggagcagaaacagaattcagctccctagtgaaactgagccatccaaacattgtccgc
tactttgcgatgaactccagagaggagaaggattccattgtggtcgacattctggcagaa
cacatcagtgggatctctctcgctgcacacctgagccactcaggccctgtgcccatgcac
cagctgcgcaaatacacagcgcagctcctggcgggcctggactacctgcaccgcaactcg
gtggtgcacaaggtgctgagcaccgccagcgtcttggtggatgctgagggcaccgtcaag
ataacagactacagcatctctaagcgcctggcagacatttgcaaggaggatgtttttgag
caaactcgagttcgctttagtgacagtgctctgccttataaaaccgggaagaaaggggat
gtgtggcgtcttggcctcctgctgttgtctcttagccaaggtcaggagtgtgaggagtat
cctgtgaccatccccagtgatctgccagctgacttccaggacttcctgaagaagtgtgtt
tgcctggacgacaaggaaaggtggagccctcaacagttgctgaaacacagctttataaac
cctcagccaaaaatgcctttggtggagcagagtcctgaagattctgggggacaagattac
atcgagaccatcatccccagcaaccagctgcccagcgctgcgttcttcactgagacacag
agacagttctctcgatacttcattgagtttgaagaactacagcttctggggaaaggagct
tttggagctgtcatcaaggtgcaaaacaagcttgatggctgttgctatgctgtgaagcgc
atccctatcaaccctgcaagcaggcagttccgcaggatcaagggcgaggtgacgctgcta
tcgcgcctgcaccatgagaacattgtacgctactacaacgcctggatcgaacggcatgag
cgcccagcggtgccagggacaccacccccagactacataccccaggcccagaacagctca
gccaccggcgggaaagcatcaggcgacactgaggaactgggcagcgtggaggctgcagca
ccaccgcccatcctcagcagctcagtggagtggagcacatctgcagagcgctctaacagc
gcccgtttcccagtcacaggccaggactccagcagcgatgaggaagatgaggacgagcgc
gatggtgtcttctcacagtcctttctacctgcttcagattctgacagtgacatcatcttt
gacaatgaagatgaaaacagtaaaagtcagaatcaggatgaagactgcaatgaaaaggac
agtcgccatgagattgagccatcagtgacgaccgaggctgtgcactacctgtacatccag
atggagtactgcgagaagagcacactgcgagacaccattgaccaggggctgttccgagac
accagccggctctggaggcttttccgagagattctggatggattagcttatatccatgag
aaaggaatgattcaccgggatttgaagcctgtcaacatttttttggattctgatgaccat
gtgaaaataggtgattttggtttggcaacagaccatctggccttcaatgctgaaggtaaa
caggacgaccaagcaggtgatcatgtgattaagtcagacccttcaggccatttgactggc
atggttggcaccgctctgtatgtaagccctgaggtccaaggaagtaccaagtctgcgtac
aaccagaaagtggatctcttcagcctgggaattatcctctttgagatgtcgtatcacccg
atggtgactgcctcagaaagaattttcgttctcaaccaacttcgagatcccacgtcaccc
aagttcccagacgactttgaggacggagagcatacaaagcagaaatctgtcatctcctgg
ctgttaaaccatgatccagccaaacggcccacagccatggagctgctcaagagtgagctg
ctccccccaccacagatggaggagtcggagctgcatgaagtgctgcaccacacgctggcc
aacacggatgggaaggcctaccgcaccatgatgagccagctcttctgccagcacagctcc
cccgccatagactacacctacgacagcgacatcctgaagggcaacttcttgattcgcaca
gccaagatccagcagcttgtgtgtgaaaccatcgtccgcgtcttcaaaaggcatggagct
gtccagctgtgcaccccgctgctgcttccccgaaacaggcaaatatatgagcacaacgaa
gccgctctgttcatggatcacagtggcatgctggtgatgcttcctttcgacctgcgggtc
ccttttgcaagatatgtggcaagaaataacatactgaatttaaagcgatactgcatagag
cgggtgttcagacctaggaagttagaccgatttcatcccaaagaactcctggaatgtgca
tttgacatcgtcacttctaccgccaacagctccctgcccactgctgaaaccatctacacc
atctatgaagtcatccaggagtttcctgcacttcaggaaagaaattacagcatttacttg
aaccatacaatgctcctaaaggcaatactcctacactgtgggatcccagaggataaactc
agtcaagtctacgttattctgtatgatgctgtgacagagaagctgactaggagggaagta
gaagctaagttctgtaacctgtccttgtcatctaatagtctgtgtcgactctataagttc
atcgagcagaagggggatttgcaagacctaacgccgaccataaactcactaataaaacag
aaaacaggcattgctcagctggtgaagtatagcttaaaagacctagaggaagttgtcggg
ctgctgaagaaacttggcgtgaagttgcaggtctccatcaacctgggcttggtttacaag
gtgcagcagcacaatggcatcatcttccagttcctggcattcagcaaacgcaggcagagg
gttgtgcctgagatccttgcagctggtggcagatatgacctgctgattcccaagttcaga
ggcccacaggctctggggccagtgcccactgctgtcggtgtcagcatagccatagacaag
atattcgccgctgtcctcaacatgggagagcctgttacagtgagctcctgtgacctcctg
gttgtcagtgctggccagatgtccatgtccagggccatcaacctaacccagaaactctgg
acggccggcatcactgcagagatcatgtatgactggtcacagtcccaggaagagttacaa
gaatactgcagacatcacgaaatcacctatgtggccctggtctctgataaagaaggaagc
catgtcaaggtcaagtcctttgagaaggagaggcaaacagaaaaacgtgtgttggaatca
gatcttgtggaccatgttatgcagaaactaaggaccaaagttggtgacgaaaggaatttc
agagacgcttctgataatcttgccgtacaaactctgaaggggtcgttttctaatgcttca
ggtttgtttgaaatccatggaacaacagtagtccccactgtgagtgttatatcaccagaa
aaactgtcggccagcaccaggaggcgacatgagattcaggtgcaaacccgacttcagact
acccttgccaatttacatcagaaaagcagtgaaattgaaattttggctgtggatctaccc
aaggagaccatcttacagtttctatcgctagagtgggacgctgatgaacaggcatttaac
acaaccgtgaaacagctgctgtcacgcctgccaaagcaaagatacctcaaactcgtctgc
gacgaaatctataacatcaaagttgagaagaaggtgtcggtgttgttcctgtacagctac
agagatgactactacagaatcctattctga

DBGET integrated database retrieval system