KEGG   Rattus norvegicus (rat): 114859
Entry
114859            CDS       T01003                                 

Gene name
Eif2ak4
Definition
(RefSeq) eIF-2-alpha kinase GCN2
  KO
K16196  eukaryotic translation initiation factor 2-alpha kinase 4 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04141  Protein processing in endoplasmic reticulum
rno05160  Hepatitis C
rno05162  Measles
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114859 (Eif2ak4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114859 (Eif2ak4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    114859 (Eif2ak4)
   05162 Measles
    114859 (Eif2ak4)
   05168 Herpes simplex virus 1 infection
    114859 (Eif2ak4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    114859 (Eif2ak4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114859 (Eif2ak4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   114859 (Eif2ak4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RWD HGTP_anticodon2 tRNA-synt_His Kinase-like ABC1 APH
Other DBs
NCBI-GeneID: 114859
NCBI-ProteinID: NP_001099214
RGD: 1311439
Ensembl: ENSRNOG00000006027
Position
3
AA seq 1649 aa
MAGGRGAAGRGPAEPQESYSQRQDHELQALEAIYGSDFQDLRPDARGRVREPPEINLVLY
PQGLAGEEVYVQVELRVKCPPTYPDVVPEIELKNTKGLSNESVNLLKSHLEELAKKQCGE
VMIFELAHHVQSFLSEHNKPPPKSFHEEMLERQAQEKQQRLLEARQKEEQEQREILHEIQ
KRKEEIKEEKKRKEMAKQERLEITSLTNQDHASKRDPAGHRAAAILHGGSPDFVGNGKAR
AHSSGRSRRERQYSVCSGEASPGSCDILYFCVGSADQLMVHKGKCVGSDEQLGKVVYNAL
ETATGSFVLLYEWVLQWQKKMGPCLTSQEKEKIDKCKKQIQGAETEFSSLVKLSHPNIVR
YFAMNSREEKDSIVVDILAEHISGISLAAHLSHSGPVPMHQLRKYTAQLLAGLDYLHRNS
VVHKVLSTASVLVDAEGTVKITDYSISKRLADICKEDVFEQTRVRFSDSALPYKTGKKGD
VWRLGLLLLSLSQGQECEEYPVTIPSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFIN
PQPKMPLVEQSPEDSGGQDYIETIIPSNQLPSAAFFTETQRQFSRYFIEFEELQLLGKGA
FGAVIKVQNKLDGCCYAVKRIPINPASRQFRRIKGEVTLLSRLHHENIVRYYNAWIERHE
RPAVPGTPPPDYIPQAQNSSATGGKASGDTEELGSVEAAAPPPILSSSVEWSTSAERSNS
ARFPVTGQDSSSDEEDEDERDGVFSQSFLPASDSDSDIIFDNEDENSKSQNQDEDCNEKD
SRHEIEPSVTTEAVHYLYIQMEYCEKSTLRDTIDQGLFRDTSRLWRLFREILDGLAYIHE
KGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFNAEGKQDDQAGDHVIKSDPSGHLTG
MVGTALYVSPEVQGSTKSAYNQKVDLFSLGIILFEMSYHPMVTASERIFVLNQLRDPTSP
KFPDDFEDGEHTKQKSVISWLLNHDPAKRPTAMELLKSELLPPPQMEESELHEVLHHTLA
NTDGKAYRTMMSQLFCQHSSPAIDYTYDSDILKGNFLIRTAKIQQLVCETIVRVFKRHGA
VQLCTPLLLPRNRQIYEHNEAALFMDHSGMLVMLPFDLRVPFARYVARNNILNLKRYCIE
RVFRPRKLDRFHPKELLECAFDIVTSTANSSLPTAETIYTIYEVIQEFPALQERNYSIYL
NHTMLLKAILLHCGIPEDKLSQVYVILYDAVTEKLTRREVEAKFCNLSLSSNSLCRLYKF
IEQKGDLQDLTPTINSLIKQKTGIAQLVKYSLKDLEEVVGLLKKLGVKLQVSINLGLVYK
VQQHNGIIFQFLAFSKRRQRVVPEILAAGGRYDLLIPKFRGPQALGPVPTAVGVSIAIDK
IFAAVLNMGEPVTVSSCDLLVVSAGQMSMSRAINLTQKLWTAGITAEIMYDWSQSQEELQ
EYCRHHEITYVALVSDKEGSHVKVKSFEKERQTEKRVLESDLVDHVMQKLRTKVGDERNF
RDASDNLAVQTLKGSFSNASGLFEIHGTTVVPTVSVISPEKLSASTRRRHEIQVQTRLQT
TLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVC
DEIYNIKVEKKVSVLFLYSYRDDYYRILF
NT seq 4950 nt   +upstreamnt  +downstreamnt
atggctgggggccgcggggccgcaggacgcggcccggctgagccgcaggagagctattca
cagagacaggaccacgagctgcaggccctggaggcgatttacggctcggacttccaggat
ctgcggccggatgcgcgcggacgggtgagagagcctcctgaaatcaatttagttctgtac
cctcagggcctggctggtgaggaagtgtacgtgcaggtggagctgagggtcaaatgccca
ccgacatacccggatgtagttcccgaaatagagttaaaaaacactaaaggtctgtcgaat
gagagtgttaatttgttaaagtcacacctggaagaactggccaaaaagcagtgtggagag
gtgatgatattcgaactggcacaccacgtgcagtcgtttctcagcgagcataacaagccc
cctccaaagtctttccatgaagaaatgctggaaaggcaggctcaggagaagcagcagagg
ttgctggaggccaggcagaaagaggagcaggagcaacgtgaaatcctccacgagattcag
aaaaggaaagaggagatcaaggaagagaagaaaaggaaggaaatggctaagcaggaacgt
ttggaaattactagtttgacaaaccaggatcatgcctctaagagagacccagcaggacac
agggcagctgccattctccatggaggctctcctgactttgtaggaaatggtaaagcccgg
gcacactcctcaggaaggtccaggcgagaacgtcagtattctgtctgtagtggtgaagcc
tctcctggctcgtgtgacatcctctacttctgtgtgggtagcgctgatcagctcatggtg
cacaaagggaaatgtgttggcagcgatgagcagctggggaaggtggtatacaatgcattg
gaaacagccacgggcagctttgtcttgttgtatgagtgggtccttcagtggcagaaaaag
atgggcccttgccttaccagtcaagagaaagagaagatcgataaatgtaaaaagcagatt
caaggagcagaaacagaattcagctccctagtgaaactgagccatccaaacattgtccgc
tactttgcgatgaactccagagaggagaaggattccattgtggtcgacattctggcagaa
cacatcagtgggatctctctcgctgcacacctgagccactcaggccctgtgcccatgcac
cagctgcgcaaatacacagcgcagctcctggcgggcctggactacctgcaccgcaactcg
gtggtgcacaaggtgctgagcaccgccagcgtcttggtggatgctgagggcaccgtcaag
ataacagactacagcatctctaagcgcctggcagacatttgcaaggaggatgtttttgag
caaactcgagttcgctttagtgacagtgctctgccttataaaaccgggaagaaaggggat
gtgtggcgtcttggcctcctgctgttgtctcttagccaaggtcaggagtgtgaggagtat
cctgtgaccatccccagtgatctgccagctgacttccaggacttcctgaagaagtgtgtt
tgcctggacgacaaggaaaggtggagccctcaacagttgctgaaacacagctttataaac
cctcagccaaaaatgcctttggtggagcagagtcctgaagattctgggggacaagattac
atcgagaccatcatccccagcaaccagctgcccagcgctgcgttcttcactgagacacag
agacagttctctcgatacttcattgagtttgaagaactacagcttctggggaaaggagct
tttggagctgtcatcaaggtgcaaaacaagcttgatggctgttgctatgctgtgaagcgc
atccctatcaaccctgcaagcaggcagttccgcaggatcaagggcgaggtgacgctgcta
tcgcgcctgcaccatgagaacattgtacgctactacaacgcctggatcgaacggcatgag
cgcccagcggtgccagggacaccacccccagactacataccccaggcccagaacagctca
gccaccggcgggaaagcatcaggcgacactgaggaactgggcagcgtggaggctgcagca
ccaccgcccatcctcagcagctcagtggagtggagcacatctgcagagcgctctaacagc
gcccgtttcccagtcacaggccaggactccagcagcgatgaggaagatgaggacgagcgc
gatggtgtcttctcacagtcctttctacctgcttcagattctgacagtgacatcatcttt
gacaatgaagatgaaaacagtaaaagtcagaatcaggatgaagactgcaatgaaaaggac
agtcgccatgagattgagccatcagtgacgaccgaggctgtgcactacctgtacatccag
atggagtactgcgagaagagcacactgcgagacaccattgaccaggggctgttccgagac
accagccggctctggaggcttttccgagagattctggatggattagcttatatccatgag
aaaggaatgattcaccgggatttgaagcctgtcaacatttttttggattctgatgaccat
gtgaaaataggtgattttggtttggcaacagaccatctggccttcaatgctgaaggtaaa
caggacgaccaagcaggtgatcatgtgattaagtcagacccttcaggccatttgactggc
atggttggcaccgctctgtatgtaagccctgaggtccaaggaagtaccaagtctgcgtac
aaccagaaagtggatctcttcagcctgggaattatcctctttgagatgtcgtatcacccg
atggtgactgcctcagaaagaattttcgttctcaaccaacttcgagatcccacgtcaccc
aagttcccagacgactttgaggacggagagcatacaaagcagaaatctgtcatctcctgg
ctgttaaaccatgatccagccaaacggcccacagccatggagctgctcaagagtgagctg
ctccccccaccacagatggaggagtcggagctgcatgaagtgctgcaccacacgctggcc
aacacggatgggaaggcctaccgcaccatgatgagccagctcttctgccagcacagctcc
cccgccatagactacacctacgacagcgacatcctgaagggcaacttcttgattcgcaca
gccaagatccagcagcttgtgtgtgaaaccatcgtccgcgtcttcaaaaggcatggagct
gtccagctgtgcaccccgctgctgcttccccgaaacaggcaaatatatgagcacaacgaa
gccgctctgttcatggatcacagtggcatgctggtgatgcttcctttcgacctgcgggtc
ccttttgcaagatatgtggcaagaaataacatactgaatttaaagcgatactgcatagag
cgggtgttcagacctaggaagttagaccgatttcatcccaaagaactcctggaatgtgca
tttgacatcgtcacttctaccgccaacagctccctgcccactgctgaaaccatctacacc
atctatgaagtcatccaggagtttcctgcacttcaggaaagaaattacagcatttacttg
aaccatacaatgctcctaaaggcaatactcctacactgtgggatcccagaggataaactc
agtcaagtctacgttattctgtatgatgctgtgacagagaagctgactaggagggaagta
gaagctaagttctgtaacctgtccttgtcatctaatagtctgtgtcgactctataagttc
atcgagcagaagggggatttgcaagacctaacgccgaccataaactcactaataaaacag
aaaacaggcattgctcagctggtgaagtatagcttaaaagacctagaggaagttgtcggg
ctgctgaagaaacttggcgtgaagttgcaggtctccatcaacctgggcttggtttacaag
gtgcagcagcacaatggcatcatcttccagttcctggcattcagcaaacgcaggcagagg
gttgtgcctgagatccttgcagctggtggcagatatgacctgctgattcccaagttcaga
ggcccacaggctctggggccagtgcccactgctgtcggtgtcagcatagccatagacaag
atattcgccgctgtcctcaacatgggagagcctgttacagtgagctcctgtgacctcctg
gttgtcagtgctggccagatgtccatgtccagggccatcaacctaacccagaaactctgg
acggccggcatcactgcagagatcatgtatgactggtcacagtcccaggaagagttacaa
gaatactgcagacatcacgaaatcacctatgtggccctggtctctgataaagaaggaagc
catgtcaaggtcaagtcctttgagaaggagaggcaaacagaaaaacgtgtgttggaatca
gatcttgtggaccatgttatgcagaaactaaggaccaaagttggtgacgaaaggaatttc
agagacgcttctgataatcttgccgtacaaactctgaaggggtcgttttctaatgcttca
ggtttgtttgaaatccatggaacaacagtagtccccactgtgagtgttatatcaccagaa
aaactgtcggccagcaccaggaggcgacatgagattcaggtgcaaacccgacttcagact
acccttgccaatttacatcagaaaagcagtgaaattgaaattttggctgtggatctaccc
aaggagaccatcttacagtttctatcgctagagtgggacgctgatgaacaggcatttaac
acaaccgtgaaacagctgctgtcacgcctgccaaagcaaagatacctcaaactcgtctgc
gacgaaatctataacatcaaagttgagaagaaggtgtcggtgttgttcctgtacagctac
agagatgactactacagaatcctattctga

KEGG   Rattus norvegicus (rat): 27137
Entry
27137             CDS       T01003                                 

Gene name
Eif2ak1
Definition
(RefSeq) eukaryotic translation initiation factor 2-alpha kinase 1
  KO
K16194  eukaryotic translation initiation factor 2-alpha kinase 1 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno05160  Hepatitis C
rno05162  Measles
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    27137 (Eif2ak1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    27137 (Eif2ak1)
   05162 Measles
    27137 (Eif2ak1)
   05168 Herpes simplex virus 1 infection
    27137 (Eif2ak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    27137 (Eif2ak1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     27137 (Eif2ak1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   27137 (Eif2ak1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo GBR2_CC PKcGMP_CC
Other DBs
NCBI-GeneID: 27137
NCBI-ProteinID: NP_037355
RGD: 70883
Ensembl: ENSRNOG00000001050
Vega: OTTRNOG00000001900
UniProt: Q63185
Position
12
AA seq 620 aa
MLGGGSVDGERDTDDDAAGAVAAPPAIDFPAEVSDPKYDESDVPAELQVFKEPLQQPTFP
FLVANQLLLVSLLEHLSHVHEPNPLHSKQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHH
NRAITHLMRSAKERVRQDPCQDNSYMQKIRSREIALEAQTSRYLNEFEELAILGKGGYGR
VYKVRNKLDGQHYAIKKILIKSATKTDCMKVLREVKVLAGLQHPNIVGYHTAWIEHVHVL
QPQDRVPIQLPSLEVLSEHEGDRNQGGVKDNESSSSIIFAELTPEKENPLAESDVKNENN
NLVSYRANLVIRSSSESESSIELQEDGLNESPLRPVVKHQLPLGHSSDVEGNFTSTDESS
EDNLNLLGQTEARYHLMLHIQMQLCELSLWDWIAERNNRSRECVDEAACPYVMASVATKI
FQELVEGVFYIHNMGIVHRDLKPRNIFLHGPDQQVKIGDFGLACADIIQKSADWTNRNGK
GTPTHTSRVGTCLYASPEQLEGSEYDAKSDMYSLGVILLELFQPFGTEMERATVLTGVRT
GRIPESLSKRCPVQAKYIQLLTGRNAAQRPSALQLLQSELFQTTGNVNLTLQMKIMEQEK
EIEELKKQLSLLSQDKGLKR
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgctggggggcggctccgtggatggcgagcgcgacacggacgacgacgcggcgggggcg
gtggccgcgcctcctgccatcgacttccccgcagaggtgtcggaccccaagtatgatgag
tccgatgtcccagcagagctccaagtgttcaaagagcccttgcagcagcccacgttccct
ttcttagtggcaaaccagctgctgctggtctccttgctggaacacttgagccatgtgcac
gagccgaacccacttcactcaaaacaggtctttaaattactgtgccagacttttatcaag
atggggctgctctcttcctttacctgcagcgatgagttcagctccctgagactccaccac
aacagagccatcactcatttaatgaggtctgccaaggagagagtccgtcaggatccttgt
caagataattcttacatgcagaaaatcagatccagggagatagctctcgaagcacagact
tcacgctacttaaatgaatttgaagagctcgccatcttaggaaaaggcggatatggaaga
gtttacaaggtccggaacaaattagatggtcagcattatgcaattaagaaaatcctgatt
aagagtgcaactaaaacggattgtatgaaggtgctacgggaagtgaaggttctggcaggc
ctccagcaccccaatatcgttggctaccacactgcatggatagagcacgttcacgtgctt
cagccacaagacagagttcccattcaactgccctctcttgaagtgttgtcagagcatgaa
ggggacagaaatcaaggtggtgttaaagataatgaaagcagttcgtccattatctttgct
gaactcaccccagaaaaagaaaaccctttagcggaatctgatgttaagaatgagaataac
aacttggtgagctacagggccaacttagtgatcaggagcagcagtgaaagcgaatcgtcc
attgagctccaagaagatggcttgaacgagtcgcctctcagaccagttgtcaagcaccag
ctgccgctggggcatagctcagacgtggaagggaattttacctccacggatgagtcttct
gaagacaatttgaacctgctggggcagacagaggcgcggtaccacctgatgctgcacatc
cagatgcagctgtgtgagctctccctgtgggactggatagctgagaggaacaatcggagc
cgggagtgcgtggatgaagcagcttgtccctatgttatggccagtgttgcaacaaagatt
tttcaagaactggtggaaggtgtcttttacatacataacatgggcatcgtccacagagat
ctgaagcctagaaatatttttcttcatggtcctgatcaacaagtgaaaataggagacttt
ggtctggcctgtgcagacatcattcagaagagcgcagattggaccaacagaaacgggaaa
ggaacgccgacacacacgtcccgagtggggacttgtctctacgcgtcacctgagcagttg
gaaggatccgagtatgatgccaagtctgatatgtacagcttgggtgtgatcctgctcgag
ctcttccagccattcgggacagaaatggagcgagcaacagtcctaacaggtgtgaggact
ggtcggataccagagtccctcagtaaaaggtgtccagtgcaagccaagtatatccagctc
ctgactgggaggaacgcggcccagagaccatctgctcttcagctactgcagagcgaactg
ttccaaacaacgggaaatgttaatctcacattgcagatgaagataatggagcaagaaaag
gaaattgaagaattaaagaagcaactaagcctcctttcgcaggacaaagggctgaagaga
tga

KEGG   Rattus norvegicus (rat): 29702
Entry
29702             CDS       T01003                                 

Gene name
Eif2ak3
Definition
(RefSeq) eukaryotic translation initiation factor 2-alpha kinase 3 precursor
  KO
K08860  eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04141  Protein processing in endoplasmic reticulum
rno04210  Apoptosis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05160  Hepatitis C
rno05162  Measles
rno05168  Herpes simplex virus 1 infection
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    29702 (Eif2ak3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    29702 (Eif2ak3)
   04137 Mitophagy - animal
    29702 (Eif2ak3)
  09143 Cell growth and death
   04210 Apoptosis
    29702 (Eif2ak3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    29702 (Eif2ak3)
   05162 Measles
    29702 (Eif2ak3)
   05168 Herpes simplex virus 1 infection
    29702 (Eif2ak3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29702 (Eif2ak3)
   05012 Parkinson disease
    29702 (Eif2ak3)
   05014 Amyotrophic lateral sclerosis
    29702 (Eif2ak3)
   05020 Prion disease
    29702 (Eif2ak3)
   05022 Pathways of neurodegeneration - multiple diseases
    29702 (Eif2ak3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    29702 (Eif2ak3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    29702 (Eif2ak3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29702 (Eif2ak3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     29702 (Eif2ak3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   29702 (Eif2ak3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like PQQ_2 Kdo PQQ ABC1 APH
Other DBs
NCBI-GeneID: 29702
NCBI-ProteinID: NP_113787
RGD: 70884
Ensembl: ENSRNOG00000006069
UniProt: Q9Z1Z1
Position
4
AA seq 1108 aa
MERATQPRPRALLLLFLLLGCAAGISAVARARSLLAPTSDTAFGLGAAAAPTSAARVPAV
ATAEVTVEDAEALPAASGEQESRATESDDDVELRPRGRSLVIISTLDGRIAALDAENHGK
KQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGDLFQWDRDRESMEAVPFTVESLLESS
YKFGDDVVLVGGKSLTTYGLSAYSGKLRYICSALGCRRWDSDEMEEEEDILLLQRTQKTV
RAVGPRSGSEKWNFSVGHFELRYIPDMETRAGFIESTFKLGGNKEDSKIISDVEEQDVDT
VIKVSVADWKVMAFSKKGGRLEWEYQFCTPIASAWLVRDGKVIPISLFDDTSYTANEEVL
EDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRVSEKFPTRPKALESVNGESAIIPLPT
IKWKPLIHSPSRTPVLVGSDEFDKCLSNDKYSHEEYSNGALSILQYPYDNGYYLPYYKRE
RNKRSTQITVRFLDSPHYSKNIRKKDPILLLHWWKEIFGTILLCIVATTFIVRRLFHPQP
HRQRKESETQCQTESKYDSVSADNSDNSWNDIKHSGYVSRYLTDFEPIQCMGRGGFGVVF
EAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLETPPEKWQE
EMDEIWLKDESTDWPLSSPSPMDAPSVKIRQMDPFSTKEQIEVIAPSPERSRSFSVGISC
GRTSSSESQFSPLEFSGTDCGDNSDSEDAAHNLQDSCLTDCDMEDGTVDGDDEGHSFELC
PSEASPYTRSREGTSSSIVFEDSGCDNASSKEDPRMNRLHNGHHYVNKLTEFKHSSSRSS
SEATLSTSPTRPTTLSLDFTRNTVDRLQPSSPKVYLYIQMQLCRKENLKDWMNRRCSMED
REHRVCLHIFLQIAEAVQFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVTAMDQDEEE
QTVLTPMPAYATHTGQVGTKLYMSPEQIHGNNYSHKVDIFSLGLILFELLYPFSTQMERV
RTLTDVRNLKFPPLFTQKYPQEHMMVQDMLSPSPMERPEATDIIENAVFENLEFPGKTVL
RQRSRSLSSSGTKHSRQPSSTFSPLPGN
NT seq 3327 nt   +upstreamnt  +downstreamnt
atggagcgcgccacccagccccgaccgcgcgcgctgctgctgctgttcctgctgctgggc
tgcgcggcggggatctcagcggtcgcgcgcgcccgcagcttgcttgctcccacatcggat
acggcatttggcttgggggcagcagccgcccctacttcagccgcgcgggtgcctgcggtg
gctacggccgaagtgaccgtggaagacgccgaggcattgcccgctgcctccggcgaacag
gagtcacgcgcgaccgagtccgatgacgacgtggaactgcggcctcgcggcaggtcctta
gtaatcatcagcactttagatggacgaattgccgcactggatgccgagaatcatgggaaa
aagcagtgggatttggacgtgggatctggttccttggtttcatctagccttagcaagcca
gaggtgtttgggaacaagatgatcattccttccctggacggagacctcttccagtgggac
cgagaccgagagagcatggaggccgtccctttcactgtggagtcccttctcgaatcttca
tacaagtttggagatgatgttgttctggttggaggaaagtctctgaccacatacgggctc
agtgcatatagtggaaagctgaggtatatctgttctgccttgggatgtcgccgatgggat
agtgatgaaatggaagaagaggaagacatcttgcttctgcaacgcacgcagaagactgtg
cgagctgtcgggcctcgaagcggcagtgagaagtggaatttcagtgttggccactttgaa
cttcggtatattccagacatggaaactagagccggattcattgaaagcacctttaaactg
ggtggaaacaaagaagactctaaaatcatttcagatgtggaagaacaagatgtggacaca
gtgataaaagtttccgttgctgattggaaggtcatggcgtttagtaagaagggaggccgc
ctagaatgggagtaccagttttgtactcccattgcgtctgcctggctggtgagggatggt
aaagtcatccccatcagtctgtttgatgacacaagttacacagccaatgaggaagttttg
gaagatgaagaagacattgtagaggctgctcggggagccacagagaacagcgtgtactta
gggatgtacagaggccagctgtacctgcaatcatccgtcagggtctcggaaaagttccct
acaaggccgaaggccttggagtctgtaaatggagaaagtgccattattcctctgccgacg
atcaaatggaagcccttaatccattctccgtctaggactcctgtcttggttgggtctgat
gaatttgacaagtgtctaagtaatgataaatattcccatgaagaatacagtaatggtgcg
ctttcaatcctacagtatccatatgacaacggttactatctgccttattacaagagagaa
aggaataagcggagcacgcagatcacggtcaggttcctggacagcccgcactacagcaag
aacatccgcaagaaggaccccatcctcctcctgcactggtggaaggaaatatttggaacg
atcttgctttgcattgtggccacgacctttatcgtgcgcaggcttttccatcctcagccc
cacaggcaacggaaggagtctgaaactcagtgccaaactgaaagtaaatacgactctgtg
agtgctgataacagcgacaacagctggaacgacattaaacactcaggatacgtgtcccga
tacctaacagattttgagccaattcagtgcatgggtcgaggcggctttggcgttgtcttt
gaagctaagaacaaagtagatgactgcaattacgccatcaagaggatccgtctcccaaac
agggagctggcacgggagaaggtaatgcgggaagtcaaagccttggctaagctggagcac
ccaggcatcgtgaggtatttcaatgcgtggctggaaacaccaccagagaagtggcaagag
gagatggatgaaatctggctgaaggacgaaagcacagactggccactcagctcccctagc
ccaatggatgccccatctgttaagatccggcagatggatcctttctctacaaaagaacag
attgaagtcatagctccttctcctgaaagaagtcggtctttctcagtgggcatttcctgt
ggccggacaagctcatctgagagccagttctctcccctggagttctcagggacagactgt
ggagacaacagtgactcagaggacgcagcccacaacctccaggacagctgcctgacagat
tgcgacatggaagatggtacagtggacggcgatgatgagggacactcctttgaactttgt
ccttctgaagcttctccctataccaggtcaagggagggaacgtcctcttccatagtgttt
gaagactctggctgtgataatgcgtccagtaaggaggaccccagaatgaatcggctgcat
aatggccaccattacgttaataagctaactgagttcaagcactccagcagcaggtcttct
tccgaagccaccttgtctacctctcctaccaggccaaccaccctaagtttagatttcacc
aggaacacggtggaccggctccagcccagctcccccaaggtgtacctgtacatccagatg
cagctgtgcaggaaggagaaccttaaagactggatgaaccggcgctgcagcatggaggac
agggagcacagagtgtgcctgcacatctttctgcagatcgcagaggcagtgcagtttctg
cacagcaagggactcatgcacagggacctcaagccttccaacatattcttcacaatggat
gatgtggtcaaagttggggactttgggctagtgactgcaatggaccaggatgaagaagag
cagacagtactgactccaatgccagcctatgctacacacacgggacaagtcgggaccaag
ctgtacatgagcccagaacagattcatggaaacaactactcccataaagtggacatcttc
tctttaggcttgattctgtttgaactcctttacccattcagcactcagatggaacgagtt
aggactttaactgatgtaagaaatctcaagtttccaccactgttcactcagaaatatccc
caagagcatatgatggttcaagacatgctttctccatcccccatggagcggcctgaagcc
acagacatcattgaaaatgctgtgtttgagaacttggagtttcctgggaaaacggttctg
agacagcggtcccgctccttgagttcatccggaactaaacattccagacagcccagcagc
acattcagcccactgcctggcaactag

KEGG   Rattus norvegicus (rat): 54287
Entry
54287             CDS       T01003                                 

Gene name
Eif2ak2
Definition
(RefSeq) interferon-induced, double-stranded RNA-activated protein kinase
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno04217  Necroptosis
rno05010  Alzheimer disease
rno05160  Hepatitis C
rno05162  Measles
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    54287 (Eif2ak2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    54287 (Eif2ak2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    54287 (Eif2ak2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    54287 (Eif2ak2)
   05171 Coronavirus disease - COVID-19
    54287 (Eif2ak2)
   05164 Influenza A
    54287 (Eif2ak2)
   05162 Measles
    54287 (Eif2ak2)
   05168 Herpes simplex virus 1 infection
    54287 (Eif2ak2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    54287 (Eif2ak2)
   05169 Epstein-Barr virus infection
    54287 (Eif2ak2)
   05165 Human papillomavirus infection
    54287 (Eif2ak2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    54287 (Eif2ak2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    54287 (Eif2ak2)
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    54287 (Eif2ak2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    54287 (Eif2ak2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     54287 (Eif2ak2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   54287 (Eif2ak2)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     54287 (Eif2ak2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     54287 (Eif2ak2)
SSDB
Motif
Pfam: Pkinase dsrm PK_Tyr_Ser-Thr ABC1 Pkinase_fungal FTA2 Kinase-like Haspin_kinase DND1_DSRM Kdo APH RIO1 SR-25
Other DBs
NCBI-GeneID: 54287
NCBI-ProteinID: NP_062208
RGD: 3402
Ensembl: ENSRNOG00000048315
UniProt: Q63184
Position
6
AA seq 513 aa
MASDTPGFYVDKLNKYSQIHKVKIIYKEISVTGPPHDRRFTFQVIIEEREFPEGEGRSKQ
EAKNNAAKLAVEILDNENKVDSHTDASEQGLIEGNYIGLVNSFAQKENLPVNFELCDPDS
QLPHRFICKCKIGQTTYGTGFGANKKEAKQLAAKNAYQKLSEKSPSKTGFVTSLSSDFSS
SSSITSNSASQSASGRDFEDIFMNGLREKRKSGVKVPSDDVLRNKYTLDDRFSKDFEDIE
EIGSGGFGQVFKAKHRIDGKTYAIKRITYNTKKAKREVQALAELNHANIVQYRVCWEGED
YDYDPENSTNGDTSRYKTRCLFIQMEFCDKGTLQQWLEKRNRSQEDKALVLELFEQIVTG
VDYIHSKGLIHRDLKPGNIFLVDEKHIKIGDFGLATALENDGNPRTKYTGTPQYMSPEQK
SSLVEYGKEVDIFALGLILAELLHICKTDSEKIEFFQLLRNGVFSDDIFDNKEKSLLQKL
LSSKPRERPNTSEILKTLAEWKNISEKKKRNTC
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggccagtgatacaccaggtttctacgtggacaaacttaacaaatactcccagatacac
aaagtaaagattatatataaagaaatttctgttacaggacctccacacgacagaaggttt
acatttcaagttataatagaagagagggaatttccagaaggtgaaggtagatcaaagcag
gaggcgaaaaataatgctgccaaattagctgtcgaaatacttgataatgaaaacaaggtg
gatagtcacacggatgcttctgaacaaggtttaatagaggggaactacattggccttgtc
aattcttttgcccagaaggaaaatctgcctgtaaattttgaactgtgtgaccccgactcc
caattgcctcacagatttatttgtaaatgcaaaatcgggcagactacgtatggtactggt
tttggcgctaacaaaaaggaggcaaagcagttggctgccaaaaatgcgtatcagaagctg
tcagagaaaagcccatcgaaaactggctttgtcacatctttatccagtgacttttccagc
agctcgtctataacaagtaactctgcttctcagtcagcatctggaagggatttcgaggac
atatttatgaatggtctcagagaaaaaaggaaatcaggagtaaaagtgccatctgatgac
gtgctaagaaataaatataccttggacgacaggtttagcaaagattttgaagacatagaa
gaaattggctcgggtggatttggccaagttttcaaagcaaaacacagaatcgatggaaag
acgtatgctattaagcgcattacatataacaccaagaaggcaaagcgtgaagtacaagca
ctagcagaactcaatcacgccaacattgttcaataccgagtttgttgggagggagaggac
tatgactatgatcccgagaacagcacaaacggtgacacaagtcgatacaagacccggtgc
ctctttatccaaatggaattctgtgataaaggaactctgcagcagtggttggaaaagaga
aatcggagtcaagaggacaaggctttggttttggagttatttgaacaaatagtgacagga
gtggattatatacactcgaaaggtttaattcatagagaccttaagccaggtaatatattt
ttagtggatgaaaaacacattaagatcggagactttggccttgcaacagccctggaaaat
gatggaaatcctcgaacaaagtatacaggaactcctcaatacatgagtccagaacaaaag
tcatcgttagtggaatatggaaaggaagtggacatctttgctttgggccttattctagct
gaacttcttcacatatgcaaaactgattcagagaaaatagagtttttccaacttctaaga
aatggcgtcttctccgatgatattttcgacaacaaggaaaaaagtcttctacagaaatta
ctctcaagtaaacccagggaacgacccaatacgtctgaaatcctgaagactttggctgag
tggaagaacatctcggagaaaaagaaaagaaacacgtgttag

DBGET integrated database retrieval system