KEGG   Rattus norvegicus (rat): 114860
Entry
114860            CDS       T01003                                 

Gene name
Gale
Definition
(RefSeq) UDP-galactose-4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00052  Galactose metabolism
rno00520  Amino sugar and nucleotide sugar metabolism
rno01100  Metabolic pathways
Module
rno_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    114860 (Gale)
   00520 Amino sugar and nucleotide sugar metabolism
    114860 (Gale)
Enzymes [BR:rno01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     114860 (Gale)
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind KR NAD_binding_4 NAD_binding_10 adh_short NmrA
Other DBs
NCBI-GeneID: 114860
NCBI-ProteinID: NP_542961
RGD: 621493
Ensembl: ENSRNOG00000009712
UniProt: Q4QRB0
Position
5q36
AA seq 348 aa
MEEKVLVTGGAGYIGSHTVLELLEAGYSPVVIDNFHNSIRGEDSMPESLRRVQELTGRSV
EFEEMDILDQAALQHLFKKHNFKAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMR
AHGVKSLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIQDLCRADTAWNA
VLLRYFNPIGAHASGRIGEDPQGIPNNLMPYVSQVAIGRREALNVFGDDYATEDGTGVRD
YIHVVDLAKGHIAALKKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARR
EGDVAACYANPSLAHEELGWTAALGLDRMCEDLWRWQKQNPSGFGAQA
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggaggagaaggtgctcgtcacgggcggggctggctacatcggtagccacacagtgttg
gagctgctggaggcgggctactcgcctgtggtcatcgacaacttccacaattccattcgt
ggagaagactccatgcctgagagcctgcgccgggtccaggagctgacaggccgctctgtg
gagtttgaggagatggacatcttggaccaggcagccctacagcacctctttaagaagcac
aattttaaggctgtcatccactttgctgggctcaaggctgtgggcgagtcagtgcagaag
cctctggattactacagagttaacctaacagggaccatccagctcctggagatcatgagg
gcccatggggtgaagagtctggtcttcagcagctcagccaccgtgtatgggaacccccag
tacctgcctctggacgaggcccaccccaccgggggctgtaccaacccctacggcaagtcc
aagttcttcattgaagagatgatccaggacctgtgccgggcagacacggcctggaacgct
gtgctgcttcggtacttcaaccccataggcgcccatgcctctggccgcatcggcgaagat
cctcagggtatccccaacaacctcatgccctatgtctcccaggtggcaatcgggcgacga
gaggccctgaatgtctttggtgatgactacgctacggaggatgggacaggtgtgagggat
tacattcatgtggtggatctggccaagggccatatagcagccttgaagaagctgaaggag
cagtgtggttgccggatctacaacctgggcacgggcacaggctattcggtcctgcagatg
gtccaagccatggagaaggcctcagggaagaagatcccgtacaaggtggtggcacggcgg
gaaggcgatgtggcggcctgttatgccaaccctagcctggcccatgaggagctgggctgg
acagcagccttggggctggacaggatgtgtgaagatctgtggcgctggcagaagcagaac
ccttcaggctttggggcgcaggcctga

DBGET integrated database retrieval system