KEGG   Rattus norvegicus (rat): 114861
Entry
114861            CDS       T01003                                 

Gene name
Scpep1, Risc
Definition
(RefSeq) serine carboxypeptidase 1
  KO
K09646  serine carboxypeptidase 1 [EC:3.4.16.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    114861 (Scpep1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.-  
     114861 (Scpep1)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S10
   114861 (Scpep1)
SSDB
Motif
Pfam: Peptidase_S10
Other DBs
NCBI-GeneID: 114861
NCBI-ProteinID: NP_596874
RGD: 620067
Ensembl: ENSRNOG00000002358
UniProt: Q920A6
Position
10q26
AA seq 452 aa
MELSRRICLVRLWLLLLSFLLGFSAGSALNWREQEGKEVWDYVTVREDARMFWWLYYATN
PCKNFSELPLVMWLQGGPGGSSTGFGNFEEIGPLDTRLKPRNTTWLQWASLLFVDNPVGT
GFSYVNTTDAYAKDLDTVASDMMVLLKSFFDCHKEFQTVPFYIFSESYGGKMAAGISLEL
HKAIQQGTIKCNFSGVALGDSWISPVDSVLSWGPYLYSVSLLDNKGLAEVSDIAEQVLNA
VNKGFYKEATQLWGKAEMIIEKNTDGVNFYNILTKSTPDTSMESSLEFFRSPLVRLCQRH
VRHLQGDALSQLMNGPIKKKLKIIPDDVSWGAQSSSVFISMEEDFMKPVIDIVDTLLELG
VNVTVYNGQLDLIVDTIGQESWVQKLKWPQLSRFNQLKWKALYTNPKSSETSAFVKSYEN
LAFYWILKAGHMVPADQGDMALKMMRLVTQQE
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggagctgtcgcggcggatttgtctcgtccgactgtggctgttgctactgtcgttcttg
ctgggcttcagcgcgggatctgccctcaactggcgggaacaagaaggcaaggaagtatgg
gattacgtgactgttcgagaggatgcacgcatgttctggtggctctactatgccaccaac
ccttgcaagaacttctcagagctgcctctggtcatgtggcttcagggtggtccaggtggt
tctagcactggatttggaaactttgaggaaatcggccctcttgacacccgactcaagcca
cggaacactacctggctgcagtgggccagtctcctgtttgtggacaatcctgtgggcacg
ggcttcagttacgtgaacacgacagatgcctacgcaaaggacctggacacggtggcttcc
gacatgatggtcctcctgaaatccttctttgattgtcataaagaattccagacggttccg
ttctacattttctcagaatcctacggaggaaagatggctgctggcatcagtttagaactt
cacaaggctattcagcaagggaccatcaagtgcaacttctctggggttgctttgggtgac
tcctggatctcccctgtggattcagtgctgtcctggggaccttacctgtacagcgtgtct
ctccttgataataaaggcttggctgaggtgtccgacattgcggagcaagtcctcaatgct
gtaaacaagggcttctacaaggaagccactcagctgtgggggaaagcagaaatgatcatt
gaaaagaacaccgacggggtaaacttctataacatcttaactaaaagcacccccgacacc
tctatggagtcgagcctcgagttcttccggagccccttagttcgtctctgtcagcgccac
gtgagacacctacaaggagacgccttaagtcagctcatgaacggtcccatcaaaaagaag
ctcaaaattatccctgacgatgtctcctggggagcccagtcgtcctccgtcttcataagc
atggaagaggacttcatgaagcctgtcatcgacatcgtggatacgttgctggaactcggg
gtcaatgtgactgtgtacaatgggcagctggatctcattgtggacaccataggtcaggag
tcctgggttcagaagctgaagtggccacagctgtccagattcaatcagctaaaatggaag
gccctgtacaccaatcctaagtcttcagaaacatctgcgtttgtcaagtcctatgagaac
ttagcgttctactggatcctaaaggcgggtcacatggttcctgctgaccaaggggacatg
gctctgaagatgatgaggctggttactcagcaggagtag

DBGET integrated database retrieval system