KEGG   Rattus norvegicus (rat): 114903
Entry
114903            CDS       T01003                                 

Gene name
Lim2, MP20, Mp19
Definition
(RefSeq) lens intrinsic membrane protein 2
  KO
K24190  lens fiber membrane intrinsic protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    114903 (Lim2)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 DUF373 Phage_holin_3_6
Other DBs
NCBI-GeneID: 114903
NCBI-ProteinID: NP_446223
RGD: 621482
Ensembl: ENSRNOG00000017681
UniProt: P54825
Position
1q22
AA seq 173 aa
MYSFMGGGLFCAWVGTILLVVATATDHWMQYRLSGSFAHQGLWRYCLGNKCFLQTESIAY
WNATRAFMILSALCATSGIIMGVLAFAQQSTFTRLSRPFSAGIMFFASTLFVLLALAIYT
GVTVSFLGRRFGDWRFSWSYILGWVALLMTFFAGIFYMCAYRMHECRRLSTPR
NT seq 522 nt   +upstreamnt  +downstreamnt
atgtacagcttcatgggtggcggcctcttctgtgcctgggtggggaccatcctgttggtg
gtagccacagcgacggaccattggatgcaataccggctgtcagggtcctttgcacaccag
ggcctgtggcgttactgcctgggcaacaagtgcttcctgcagacagagagcatcgcatac
tggaatgccacgcgggctttcatgatcctgtctgccctgtgtgccacctcgggcatcatc
atgggtgtcctggcctttgcgcagcaatccaccttcacccgcctctccaggcccttctct
gctggcatcatgttttttgcctccacccttttcgtcctgttggccttggccatttacacc
ggagtcaccgttagtttcctcggccgccgctttggggactggcgcttttcatggtcttac
atcctgggctgggtggccctgctcatgaccttctttgcaggaattttctacatgtgtgcc
taccggatgcatgagtgccggcgcctatccaccccacgctga

DBGET integrated database retrieval system