KEGG   Rattus norvegicus (rat): 115771
Entry
115771            CDS       T01003                                 

Gene name
Usp2, UBP-t
Definition
(RefSeq) ubiquitin specific peptidase 2
  KO
K11833  ubiquitin carboxyl-terminal hydrolase 2 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    115771 (Usp2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    115771 (Usp2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     115771 (Usp2)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   115771 (Usp2)
Ubiquitin system [BR:rno04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    115771 (Usp2)
SSDB
Motif
Pfam: UCH UCH_1
Other DBs
NCBI-GeneID: 115771
NCBI-ProteinID: NP_446226
RGD: 621073
Ensembl: ENSRNOG00000006663
UniProt: Q5U349
Position
8q22
AA seq 618 aa
MSQLSSTLKRYTESSRYTDAPYAKSGYGTYTPSSYGANLAASFLEKEKLGFKPVSPTSFL
PRPRTYGPSSILDCDRGRPLLRSDITGGSKRSESQTRGNERPSGSGLNGGSGFPYGVTSN
SLSYLPMNARDQGVTLGQKKSNSQSDLARDFSSLRTSDSYRTSDGYRASDGFRIDPGNLG
RSPMLARTRKELCALQGLYQATSRSEYLTDYLENYGRKGSAPQVLTQAPPSRVPEVLSPT
YRPSGRYTLWEKNKGQASGPSRSTSPGRDTMNSKSAQGLAGLRNLGNTCFMNSILQCLSN
TRELRDYCLQRLYMRDLGHTSSAHTALMEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYA
PRFVGYNQQDAQEFLRFLLDGLHNEVNRVAARPKPSPESLDHLPDEEKGRQMWRKYLERE
DSRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDV
LDGDEKPTCCRCRARKRCIKKFSVQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLD
LREFASENTNHAVYNLYAVSNHSGTTMGGHYTAYCRSPVTGEWHTFNDSSVTPMSSSQVR
TSDAYLFFYELASPPSRM
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgtcccagctctcctccaccctgaagcgctatacagaatcgtcccgctacacagatgcc
ccttatgccaaatcgggctatggcacctacaccccttcttcctatggggccaacctggcc
gcctccttcctggagaaggaaaaacttggtttcaagccggtctcccccaccagcttcctc
ccacggccccgcacctacggcccctcctccatcctggactgtgacaggggccgccccctg
ctgagatctgacatcactgggggtagtaagcggtctgagagccagacccgtggcaatgaa
aggccctcaggcagtggactcaacggaggcagtggatttccttatggagtgaccagcaac
tccctcagctacctgcccatgaatgccagagaccagggcgtgaccttgggccagaagaaa
tcgaacagccaatcagacctggcccgggatttctccagcctccggacctcagatagctac
aggacttcagatggctaccgggcctcagatggctttaggatagaccccggaaacctgggt
cgcagccccatgctggcccgcacacgtaaggagctctgtgccctgcagggcctctaccaa
gcaaccagccgttctgagtacctaacagactatctggagaactatggccgcaagggcagt
gcaccacaggtgctcacacaggcccctccctcccgagtccccgaagtcctcagtcccacc
taccgaccaagtggccgctacacactgtgggagaagaacaagggccaggcttctgggccc
agccgctccacttctccagggcgagacaccatgaattcaaagagtgcccagggtctggct
ggtcttcgaaaccttgggaacacgtgcttcatgaactcaattcttcagtgtctgagcaac
acccgcgagttgagagattactgcctccagaggctgtacatgcgggacctcggccatacc
agcagtgcacacacagctctcatggaagagtttgcaaaactaatccagaccatatggacg
tcatcccccaatgatgtggtgagcccatctgagttcaagacccagatccagagatatgca
ccacgcttcgttggctataatcagcaggatgctcaggaattcctccgtttccttctggat
ggcctccacaacgaggtgaaccgggtggcagcaaggcctaagcccagccctgagagcctt
gatcatctccctgatgaagagaaagggcgacagatgtggaggaagtatctagaaagggaa
gacagtcggattggggatctcttcgttgggcagctaaagagctccctgacgtgcaccgac
tgcggctactgctctacagtgttcgatcccttctgggacctctcgttgcccattgcaaag
agaggctatcctgaagtgacgttaatggattgtatgaggctcttcaccaaagaggatgtg
ttggatggggatgagaaaccaacatgctgccgctgccgggccagaaaacgatgtataaag
aagttctctgtccagaggttcccaaagatcttggtgctccacctgaagcggttctcagaa
tccaggatacgaaccagcaagctcacaacatttgtgaatttcccactaagagacctggac
ttgagagaatttgcttcagaaaacaccaaccatgctgtttacaacctgtatgctgtgtcc
aatcactccggaaccaccatgggaggtcactatacagcctactgccgaagtccggttacg
ggcgaatggcacactttcaatgactccagtgtcacacccatgtcctccagccaagtgcgc
accagcgacgcctatttgttcttctatgaactggccagtccaccctcccgtatgtag

DBGET integrated database retrieval system