KEGG   Rattus norvegicus (rat): 116455
Entry
116455            CDS       T01003                                 

Gene name
Atp6v0a2
Definition
(RefSeq) V-type proton ATPase 116 kDa subunit a
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05152  Tuberculosis
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    116455 (Atp6v0a2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    116455 (Atp6v0a2)
   04142 Lysosome
    116455 (Atp6v0a2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    116455 (Atp6v0a2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    116455 (Atp6v0a2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    116455 (Atp6v0a2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    116455 (Atp6v0a2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    116455 (Atp6v0a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    116455 (Atp6v0a2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   116455 (Atp6v0a2)
SSDB
Motif
Pfam: V_ATPase_I Takusan
Other DBs
NCBI-GeneID: 116455
NCBI-ProteinID: NP_446227
RGD: 621006
Ensembl: ENSRNOG00000052704
UniProt: Q2I6B1
Position
12
AA seq 856 aa
MGSLFRSESMCLAQLFLQSGTAYECLSALGEKGLVQFRDLNQNVSSFQRKFVGEVKRCEE
LERILVYLVQEITRADIPLPEGEASPPAPPVKHVLEMQEQLQKLEVELREVTKNKEKLRK
NLLELVEYTHMLRVTKTFLKRNVEFEPTYEEFPALESDSLLDYSCMQRLGAKLGFVSGLI
QQGKVEAFERMLWRACKGYTIVTYAELDEALEDPETGEVIKWYVFLISFWGEQIGHKVKK
ICDCYHCHIYPYPNTAEERREIQEGLNTRIQDLYTVLHKTEDYLRQVLCKAAESVCSRVI
QVRKMKAIYHMLNMCSFDVTNKCLIAEVWCPEVDLPGLRRALEEGSRESGATIPSFMNTI
PTKETPPTLIRTNKFTEGFQNIVDAYGVGSYREVNPALFTIITFPFLFGVMFGDLGHGFV
MFLFALLLVLNENHPRLSQSQEILRMFFDGRYILLLMGLFSVYTGLIYNDCFSKSLNLFG
SGWNVSAMYSSSHSPEEQRKMVLWNDSTIRHSRTLQLDPNIPGVFRGPYPFGIDPIWNLA
TNRLTFLNSFKMKMSVILGIFHMTFGVILGIFNHLHFRKKFNIYLVSVPEILFMLCIFGY
LIFMIIYKWLAYSAETSREAPSILIEFINMFLFPSSETHGLYPGQAHVQKVLLALTVLAV
PVLFLGKPLFLLWLHNGRSCFGVSRSGYTLVRKDSEEEVSLLGSQDIEEGNNRMEEGCRE
MTCEEFNFGEILMTQAIHSIEYCLGCISNTASYLRLWALSLAHAQLSDVLWAMLMRVGLR
VDNTYGVLLLLPVMTFFAVLTVFILLVMEGLSAFLHAIRLHWVEFQNKFYVGAGTKFVPF
SFSLLSSKFSKDDSIA
NT seq 2571 nt   +upstreamnt  +downstreamnt
atgggctccctcttccgtagcgagagcatgtgcctggcgcagctcttcctgcagtcgggc
acggcctacgagtgtctgagcgcgcttggcgagaagggcctggtgcagttccgagacctc
aaccaaaatgtaagttctttccaaagaaaattcgttggtgaggtaaagaggtgtgaagaa
ctagaacgaatattggtgtacctggtgcaggaaatcaccagagctgatattcccctgcct
gagggagaggccagtcctcccgcaccacctgttaaacatgttctagaaatgcaggagcag
ctgcagaagctcgaggtggagctcagagaagtcaccaagaacaaggagaagctgaggaag
aacctgctggagctggtggagtatacccacatgctgagggtcaccaagaccttccttaaa
cggaacgtggagtttgagccaacttacgaagagttccccgccttagagagcgactctctg
ttggactacagctgcatgcagcggctgggcgccaagctgggattcgtttctggcctgatt
cagcaaggcaaagtggaagcatttgaaagaatgctgtggcgggcctgcaaagggtacacc
attgtgacctatgcagagctggacgaggccctggaagaccctgagacgggtgaagtcata
aagtggtatgtgttcctgatctcgttttggggagagcagattggccacaaggttaagaag
atctgtgactgttaccactgccacatctacccgtatccaaacacggccgaggagcgcagg
gagatccaggaggggctcaatactcggatccaagacctttacactgtgctgcacaaaacg
gaggactacctgcggcaagtgctgtgcaaggctgccgagtccgtgtgcagccgtgtgata
caggtgcggaagatgaaagccatctaccacatgctcaacatgtgcagctttgacgtcacc
aacaagtgcctcatagctgaggtctggtgccccgaggtggacctgcccggcttgcgcaga
gcgctggaggaaggctcgagagaaagtggagctacaatcccctcgttcatgaacacaatc
cctacgaaagaaacgccgcccactctgatccgcaccaacaaattcactgaaggtttccag
aacatcgtggatgcctacggtgttgggagctacagagaagtgaacccagctttgttcacc
atcatcaccttcccgttcctgtttggcgtgatgtttggtgacttggggcacggctttgtc
atgttcctgtttgccctcttactggtgttgaatgagaatcaccccagactaagccagtca
caggagatccttaggatgttctttgatggccgatatatcctgctgctgatggggctgttc
tccgtgtacaccggcctcatctacaacgactgcttctccaagtccctgaacctctttggc
tctgggtggaacgtgtctgccatgtacagttccagccactccccagaggagcaaaggaaa
atggtgctttggaatgacagcaccatcaggcacagcaggacgctgcagctggacccaaac
atccctggagttttccgaggcccctaccctttcggcatcgatcctatttggaacctggcc
acaaatcgcctcacgttcctcaactccttcaagatgaagatgtctgtgattttaggaatt
tttcacatgacctttggtgtcattctgggaatatttaaccacttgcacttcaggaagaag
ttcaacatctacctggtctcggtccccgagatcctgtttatgctctgcatctttgggtac
ctgattttcatgatcatctacaagtggctggcgtactcggcagagacctccagagaggcc
cccagcatcctcatcgagttcattaacatgttcctgttcccgtccagtgagacacacggc
ctctacccggggcaggcacacgtccagaaggtgttgttggctctcaccgtgctggctgtc
cctgtgctcttcttgggaaagccgctctttctgctgtggctgcacaatgggcgcagttgc
ttcggcgtgagccggagcggctacacgctcgtgaggaaggacagcgaggaagaggtgtct
ctcctaggcagccaggacatagaggaggggaacaaccgcatggaagagggctgccgagaa
atgacctgtgaggagtttaacttcggggagatcctgatgactcaggccatccactccatc
gagtactgccttggctgcatctccaacactgcgtcctacctgaggctttgggctctcagc
ctggcacacgcacagctctcggatgtgctgtgggccatgctgatgcgtgtaggcctgcgt
gtggacaacacttacggggtcctgctgctgctgcccgtcatgactttctttgcagttctg
accgtttttatccttctggtcatggaagggctttctgcatttctccacgccatccggctt
cactgggtagaatttcagaacaaattctacgttggtgcaggtaccaaattcgttcctttc
tccttcagtctgctgtcctccaagttcagtaaagatgacagcatagcatga

KEGG   Rattus norvegicus (rat): 116664
Entry
116664            CDS       T01003                                 

Gene name
Atp6v1f
Definition
(RefSeq) V-type proton ATPase subunit F
  KO
K02151  V-type H+-transporting ATPase subunit F
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    116664 (Atp6v1f)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    116664 (Atp6v1f)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    116664 (Atp6v1f)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    116664 (Atp6v1f)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    116664 (Atp6v1f)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    116664 (Atp6v1f)
  09163 Immune disease
   05323 Rheumatoid arthritis
    116664 (Atp6v1f)
SSDB
Motif
Pfam: ATP-synt_F
Other DBs
NCBI-GeneID: 116664
NCBI-ProteinID: NP_446336
RGD: 621552
Ensembl: ENSRNOG00000007392
UniProt: P50408
Position
4
AA seq 119 aa
MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDD
IGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTAEDLR
NT seq 360 nt   +upstreamnt  +downstreamnt
atggcgggcaggggtaaactaatcgcagtgattggagacgaggacacggtgactggtttc
ctgttgggcggcataggggagcttaacaagaaccgccaccctaatttcctggtagtggag
aaggataccaccatcaatgaaatcgaagacactttcaggcagtttctaaacagggatgac
atcggcatcattctcatcaaccagtacatcgcagagatggttcggcacgccctcgatgcc
caccagaggtccattccagccgtcctggagatcccgtccaaggagcatccctacgacgca
gccaaagactccatcctgcgcagggccaagggcatgttcactgctgaagacctgcgctag

KEGG   Rattus norvegicus (rat): 117596
Entry
117596            CDS       T01003                                 

Gene name
Atp6v1b2
Definition
(RefSeq) V-type proton ATPase subunit B, brain isoform
  KO
K02147  V-type H+-transporting ATPase subunit B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    117596 (Atp6v1b2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    117596 (Atp6v1b2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    117596 (Atp6v1b2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    117596 (Atp6v1b2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    117596 (Atp6v1b2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    117596 (Atp6v1b2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    117596 (Atp6v1b2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    117596 (Atp6v1b2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   117596 (Atp6v1b2)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N DUF2481
Other DBs
NCBI-GeneID: 117596
NCBI-ProteinID: NP_476561
RGD: 620284
Ensembl: ENSRNOG00000011891
UniProt: P62815
Position
16
AA seq 511 aa
MALRAMRGIVNGAAPELPVPTGGPMAGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVIL
DHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILR
TPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGM
NSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMET
ARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDM
SSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDD
ITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSN
QLYACYAIGKDVQAMKAVVGEEALTSDDLLYLEFLQKFEKNFITQGPYENRTVYETLDIG
WQLLRIFPKEMLKRIPQSTLSEFYPRDSAKH
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggcgttgcgagcgatgcggggaatcgtgaacggggccgcgcccgagctgcccgtgccc
accggtgggccgatggccggagctcgggagcaggcgctggcggtgagccggaactacctc
tcccagcctcgtctcacctacaagactgtctctggagtgaatggtccactagtgatctta
gatcatgtaaagtttcccagatatgctgagattgtccacttgacattaccagatggcaca
aaaagaagtgggcaagttctagaagttagtggctccaaagccgtggttcaggtatttgaa
ggaacatccggcatagatgccaagaaaacatcctgtgagtttactggagatattctccgc
acaccagtgtctgaggatatgcttggtcgagtattcaatggatcaggaaaacccattgac
cgaggtcctgtggtgttggccgaagacttccttgacatcatgggtcagccaatcaaccct
cagtgtcgcatctacccagaagagatgattcagacgggcatttctgccatcgatggcatg
aacagtattgcgaggggacagaaaatccccatcttttctgctgccgggttaccacacaac
gagattgcagctcagatctgtcgccaggctggtttggtaaagaaatccaaagacgtggta
gactacagtgaagaaaactttgccattgtgtttgctgctatgggagtaaacatggaaaca
gcccggttcttcaaatctgactttgaagaaaatggctcaatggacaatgtctgccttttc
ttgaatctggctaatgacccaactatcgagaggatcatcactcctcgcctggctctgacc
accgctgagtttctggcttaccagtgtgagaagcatgtcctggtcatcctgacagatatg
agttcttacgctgaagcacttcgagaggtttcagctgccagggaagaggttcctggtcgg
cgaggcttccccggctacatgtatacggatttagccaccatctatgaacgcgctgggcga
gtggaaggtagaaatggctctattacccaaatccctattctcaccatgcccaatgatgat
atcactcatcctatccctgacttgactgggtatattactgagggccagatctatgtggac
agacagctgcacaacagacagatttaccctcctattaatgtgctgccctcactctctcgg
ttaatgaagtcagctattggagaaggaatgaccaggaaggatcatgctgatgtgtctaac
cagttgtacgcatgctatgctatcggtaaggatgtgcaagccatgaaagctgtggtggga
gaagaagccctgacctcagatgacctcctttacttggaatttctgcagaagtttgagaaa
aacttcattactcagggtccctatgaaaatcgaactgtctatgagactttggacattggc
tggcagttgcttcgaatcttccccaaagaaatgctgaagaggatccctcagagtaccctg
agcgaattttaccctcgagactctgcaaagcactag

KEGG   Rattus norvegicus (rat): 170667
Entry
170667            CDS       T01003                                 

Gene name
Atp6v0c
Definition
(RefSeq) V-type proton ATPase 16 kDa proteolipid subunit
  KO
K02155  V-type H+-transporting ATPase 16kDa proteolipid subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05152  Tuberculosis
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    170667 (Atp6v0c)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    170667 (Atp6v0c)
   04142 Lysosome
    170667 (Atp6v0c)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    170667 (Atp6v0c)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    170667 (Atp6v0c)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    170667 (Atp6v0c)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    170667 (Atp6v0c)
  09163 Immune disease
   05323 Rheumatoid arthritis
    170667 (Atp6v0c)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 170667
NCBI-ProteinID: NP_570836
RGD: 621394
Ensembl: ENSRNOG00000006542
UniProt: P63081
Position
10
AA seq 155 aa
MADIKNNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVV
MAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG
TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgacatcaagaacaaccccgaatattcttcgtttttcggtgtcatgggcgcctcg
tccgccatggtcttcagcgccatgggagctgcctatggcacagccaagagtggcactggc
atcgcagccatgtcggtcatgaggccagagctgatcatgaagtccatcatcccagtggtt
atggctgggatcatcgccatctacggcctggtggttgcagtacttatcgctaactccctg
actgatggcatcaccctctacaggagttttcttcaactgggtgctggcctgagtgtgggg
ctgagtggcctggctgctggctttgccattggcattgtcggagatgctggtgtccggggc
actgcccagcagcctcgactgttcgtgggcatgatcctgatcctcatctttgcggaggtg
cttggcctctacggtctcatcgtggccctaatcctctccacaaagtag

KEGG   Rattus norvegicus (rat): 289407
Entry
289407            CDS       T01003                                 

Gene name
Atp6v1g3
Definition
(RefSeq) V-type proton ATPase subunit G 3
  KO
K02152  V-type H+-transporting ATPase subunit G
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    289407 (Atp6v1g3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    289407 (Atp6v1g3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    289407 (Atp6v1g3)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    289407 (Atp6v1g3)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    289407 (Atp6v1g3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    289407 (Atp6v1g3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    289407 (Atp6v1g3)
SSDB
Motif
Pfam: V-ATPase_G Prp31_C RNase_Y_N V-ATPase_G_2 OmpH Muted
Other DBs
NCBI-GeneID: 289407
NCBI-ProteinID: NP_001099461
RGD: 1304635
Ensembl: ENSRNOG00000022480
UniProt: D3ZTZ4
Position
13
AA seq 118 aa
MTSQSQGIQQLLQAEKRAKDKLDEAKKRKGKRLRQAKEEAVAETDQYRMQREKEFRLKQS
KIMGSQSHLSDELEEQTLEKIKELSGSYHKCMDSVIKQLLSMVCEMKPEVHVNYRATS
NT seq 357 nt   +upstreamnt  +downstreamnt
atgaccagccagtctcaggggattcaacagctcctgcaagcagagaaaagggccaaagac
aagctggatgaggcaaagaagagaaaaggaaagagactgaggcaagctaaggaagaagcc
gtggcagagaccgaccagtacagaatgcagagggagaaggagttccgcctgaagcagtct
aagataatgggctctcagagccacctctcggatgaactcgaagagcaaacactggagaag
ataaaggaattgagcggaagctaccacaagtgtatggacagcgtgattaagcagctgttg
agcatggtgtgtgagatgaaaccagaagtccacgtgaactacagagccaccagctga

KEGG   Rattus norvegicus (rat): 291969
Entry
291969            CDS       T01003                                 

Gene name
Atp6v0d1
Definition
(RefSeq) V-type proton ATPase subunit d 1
  KO
K02146  V-type H+-transporting ATPase subunit d
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05152  Tuberculosis
rno05165  Human papillomavirus infection
rno05203  Viral carcinogenesis
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    291969 (Atp6v0d1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    291969 (Atp6v0d1)
   04142 Lysosome
    291969 (Atp6v0d1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    291969 (Atp6v0d1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    291969 (Atp6v0d1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    291969 (Atp6v0d1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    291969 (Atp6v0d1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    291969 (Atp6v0d1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    291969 (Atp6v0d1)
SSDB
Motif
Pfam: vATP-synt_AC39 Nab2p_Zf1
Other DBs
NCBI-GeneID: 291969
NCBI-ProteinID: NP_001011927
RGD: 1306159
Ensembl: ENSRNOG00000017235
Vega: OTTRNOG00000002201
UniProt: Q5M7T6
Position
19
AA seq 351 aa
MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLAN
EASPLTVSVIDDKLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQR
SIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEI
IRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKL
FPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVK
LNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtcgttcttcccggagctttatttcaacgtggacaatggctacttggagggattagtg
cgcggcctgaaggccggggtgctcagccaggcggactacctcaacctggtgcagtgcgag
acgctcgaggacttgaaactgcacctgcagagtacagattatggcaacttcctggccaat
gaagcgtcacctctgacggtgtcagtcatcgatgacaagctcaaggagaagatggtagta
gagttccgccacatgagaaaccatgcctacgagccacttgccagcttcctggacttcatt
acttacagctacatgattgacaacgtgatcctgctcatcacgggcacactgcaccagcgt
tcaatagctgaacttgtgcccaagtgccatccgctaggcagttttgagcagatggaggct
gtgaacatcgcacagacacccgcagagctctacaatgccattctggtggacacgcccctg
gcggcttttttccaggactgcatctcagagcaggaccttgatgagatgaacattgagata
atccgaaacacgctttacaaggcttatctggagtccttctacaagttctgtactctgtta
gggggaaccacagctgatgccatgtgtcctatcctagagtttgaagcagatcgccgagct
ttcatcatcaccatcaactctttcggcacagagctttccaaggaggaccgtgccaagctc
tttccacactgtggccgactctaccctgagggcttggctcagctggctcgggctgatgac
tatgaacaggtcaagaatgtagctgattactacccggaatacaaactgctttttgagggt
gcaggtagcaatcctggagacaagaccctggaggaccgattctttgaacatgaggtgaag
ctgaacaagctggccttcctgaaccagttccactttggtgtcttttatgcctttgtgaag
cttaaggaacaggaatgtcgcaacattgtgtggattgctgagtgcattgcccagcgccat
cgcgccaagatcgacaactatatccccatcttctag

KEGG   Rattus norvegicus (rat): 293650
Entry
293650            CDS       T01003                                 

Gene name
Tcirg1
Definition
(RefSeq) V-type proton ATPase 116 kDa subunit a
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05152  Tuberculosis
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    293650 (Tcirg1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    293650 (Tcirg1)
   04142 Lysosome
    293650 (Tcirg1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    293650 (Tcirg1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    293650 (Tcirg1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    293650 (Tcirg1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    293650 (Tcirg1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    293650 (Tcirg1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    293650 (Tcirg1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   293650 (Tcirg1)
SSDB
Motif
Pfam: V_ATPase_I APG6_N FKS1_dom1 DUF2730
Other DBs
NCBI-GeneID: 293650
NCBI-ProteinID: NP_954520
RGD: 735136
Ensembl: ENSRNOG00000017220
UniProt: Q2I6B0
Position
1
AA seq 834 aa
MGSMFRSEEVALVQLLLPTASAYNCVSQLGELGLVEFRDLNESVSAFQRRFVVEVRRCEE
LEKTFTFLREEVQRAGLTLTPPEGTLPAPPPRDLLRIQEETDRLAQELRDVRGNQQALRA
QLHQLQLHSAVLGQSHAPPMAAVHTEGPTTERTPLLSATPGPHADLKVNFVAGAVEPCKA
AALERLLWRACRGFLIASFKETEGQLEDPVTGEPATWMTFVISYWGEQIGQKVRKITDCF
HCHVFPYLEQEEARLRTLQQLQQQSQELQEVLGETERFLSQVLGRVQQLLPPGQVQIRKM
KAVHLTLNQCSVNTTHKCLIAEVWCATRDLPTVQQALQSGSSEEGVSAVAHRIPCQDMPP
TLIRTNRFTSSFQGIVDAYGVGRYREVNPAPYTIITFPFLFAVMFGDVGHGLLMFLFALA
MVLTENQPAVKTTQNEIWQTFFGGRYLPLLMGLFSIYTGFIYNECFSRATTIFPSGWSVA
AMANQSGWSDEYLSQHPMLTLNPNITGVFLGPYPFGIDPIWSLATNHLSFLNSFKMKMSV
ILGVTHMAFGVFLSIFNHVHFGQAHRLLLETVPELIFLLGLFGYLVFLIVYKWLYVSAAS
ASSAPSILIHFINMFLFSQNPTNRLLFHGQVVVQYALVVLALATVPILLLGTPLYLLRQH
HRRNTQRRPTAGRQDEDSDKLLASPDASTLENSWSPDEEKAGSSGDEEAEFVPSEIFMHQ
AIHTIEFCLGCISNTASYLRLWALSLAHAQLSEVLWAMVMRIGLGMGREIGVASVVLVPV
FAAFAVLTVAILLVMEGLSAFLHALRLHWVEFQNKFYSGTGYKLSPFAFTVDSD
NT seq 2505 nt   +upstreamnt  +downstreamnt
atgggctccatgttccggagtgaagaggtggccttggtccagctcctgttgcccacagca
tctgcctacaactgtgtgagccagctgggtgagctgggcctcgtggagtttagagacctc
aacgagtcggtgagtgccttccagagacgcttcgtggtagaggtccggcgctgcgaggag
ctggagaagaccttcaccttcttgcgggaagaagtgcagcgggcaggcctgacactgacc
ccacccgaggggacactgccagcaccgcctccccgagacctgctgcgcatccaggaggaa
acggaccgcttggcccaggagcttcgggatgttcgaggcaaccaacaggcacttcgggcc
cagctgcaccagctacagctccactcagccgtgctgggccagagccacgcccctccgatg
gcagctgtccatacggagggacccaccactgagagaacacccctgctttcagccacccca
gggccacatgcagacctgaaggtcaattttgtggcaggtgctgtggagccttgcaaggct
gcagccctggagcgcctgctttggagagcttgccgcggcttcctcattgccagctttaag
gagactgaggggcagctggaggacccggtgacgggtgagcctgcaacttggatgaccttt
gtcatctcctactggggtgagcagatcggacagaaggttcggaagatcacagactgcttt
cactgtcatgtcttcccgtacctggagcaggaggaagcccggctcaggaccttgcagcag
ctgcagcagcagagccaggagcttcaggaggtcctgggggagacagaacggttcctgagc
caggtgttgggccgggtgcagcagctgctgcccccagggcaggtgcagatccggaagatg
aaggccgtgcacctgaccctcaaccagtgcagtgtgaacaccacacacaagtgcctcatt
gcggaggtctggtgtgccacgagggaccttcccactgtacagcaggcgctgcagagcggc
tcgagtgaggaaggagtgagtgctgtggctcaccgtatcccttgccaggacatgcctcca
actctcatcaggaccaaccgcttcacctccagcttccagggcattgtggatgcctatggt
gtgggccgatacagggaagtcaaccctgctccctacaccatcatcacattccccttcctc
tttgctgtgatgtttggcgacgtgggccacggactgctcatgtttctcttcgccctggct
atggtcctcactgagaaccaaccagctgtaaagaccacgcaaaatgagatctggcagacc
ttctttgggggtcgctacctacccctgctcatgggtctgttctccatctacacgggcttc
atctacaacgagtgcttcagccgagccaccactattttcccctcaggctggagtgtggct
gccatggccaaccagtcaggctggagtgacgagtatctgtcccagcaccccatgcttacc
ctgaaccctaacatcactggtgtcttcctcggaccttatcccttcggcattgacccgatc
tggagcctggccaccaaccacctgagcttcctcaactccttcaagatgaagatgtctgtc
atccttggggtcacacacatggcctttggggtgttcctcagcatcttcaaccatgtgcac
tttggccaggcccaccggctactgctggagaccgtgcctgagctcatcttcctgttgggc
ctctttggctaccttgttttcctcattgtctacaagtggctctacgtctcagctgccagc
gcctcctcggcccccagtatcctcattcacttcatcaatatgttcctcttctcccaaaac
cccaccaatcggctgctcttccacgggcaggtagtggtacagtatgcgctggtggtcctg
gctttggccacagttcctatcctgctgctgggcacacccttgtaccttctgcgccagcac
caccgaagaaacactcagagaaggcctacagcaggcagacaggatgaggacagtgacaag
cttctggcctccccggatgcttccaccttggagaacagctggagccctgatgaggagaag
gctgggagctcaggagatgaagaagctgagtttgtcccttcggagatcttcatgcaccaa
gccatccacaccattgagttctgcctgggctgcatctccaacacagcctcctacttgcgt
ctctgggccctgagcctggctcatgctcagctgtctgaggtcctgtgggccatggtgatg
cgcataggcctaggcatgggccgagagattggtgtggcatctgtggtgctggtccctgtg
tttgctgcctttgctgtgttgactgtggccatcttgctagtgatggaggggctctcagcc
ttcctacatgccctgcggttgcactgggtggagttccagaacaagttctattcagggacc
ggctacaagctcagccccttcgccttcactgtggacagtgactag

KEGG   Rattus norvegicus (rat): 296981
Entry
296981            CDS       T01003                                 

Gene name
Atp6v0a4
Definition
(RefSeq) V-type proton ATPase 116 kDa subunit a
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05152  Tuberculosis
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    296981 (Atp6v0a4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    296981 (Atp6v0a4)
   04142 Lysosome
    296981 (Atp6v0a4)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    296981 (Atp6v0a4)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    296981 (Atp6v0a4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    296981 (Atp6v0a4)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    296981 (Atp6v0a4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    296981 (Atp6v0a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    296981 (Atp6v0a4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   296981 (Atp6v0a4)
SSDB
Motif
Pfam: V_ATPase_I IFP_35_N
Other DBs
NCBI-GeneID: 296981
NCBI-ProteinID: NP_001100061
RGD: 1305055
Ensembl: ENSRNOG00000013428
UniProt: D4A1H0
Position
4
AA seq 801 aa
MASVFRSEEMCLSQVFLQVEAAYCCVAELGELGLVQFKDLNANVNSFQRKFVNEVRRCES
LERILRFLEDEMQNEIIIQVPDKDPGTPLPREMITLETTLEKLEGELQEANQSHQALKKS
FLELTELKYLLKKTQDFFEVNLGFTAGVINRERMASFERLLWRVCRGNVYLKFSEMDTLL
EDPVTKEEIKKNIFIIFYQGEQLRLKIKKICDGFRATIYPCPEHAAERREMLASVNVRLE
DLITVITQTESHRQRLLQEAASNWHSWVIKVQKMKAVYHVLNMCNIDVTQQCIIAEIWFP
VADTRHIKKALEQGMELSGSSMVPIMTEVETKTDPPTFNRTNKFTAGFQNIVDAYGVGSY
REINPAPYTIITFPFLFAVMFGDCGHGMVMLMAALWMVLNERHLLAQKSTNEMWNIFFNG
RYLILLMGIFSIYTGLIYNDCFSKSFNIFGSSWSVQPMFRNGTWNAHVVEQNPYLQLDPA
IPGVYSGNPYPFGIDPIWNLASNKLTFLNSYKMKMSVILGIVHMIFGVILSLFNHIYFRR
TLNIILQFIPEMIFMLSLFGYLVFMIIFKWCQYDAHTSQKAPSILIHFIGMFLFDYDDSS
NAPLYGHQQEVQTFFVIIALVSVPWMLLIKPFILRAKHQKSQLQSFTIHEDAMEGPSVKK
TAGAHGTKEGHEEEFNFGDIFVHQAIHTIEYCLGCISNTASYLRLWALSLAHAELSEVLW
TMVMSIGLRLRGWGGLVGVFIIFAVFAVLTVAILLVMEGLSAFLHALRLHWVEFQNKFYE
GAGFKFSPFSFKHVLEGAAEE
NT seq 2406 nt   +upstreamnt  +downstreamnt
atggcgtctgtgtttcgaagtgaggagatgtgcttatcccaagtgtttctccaggtggag
gctgcatactgctgtgtggctgagctgggggagcttggtttggttcaattcaaagatctg
aacgcaaatgtaaacagcttccagaggaagtttgtgaatgaggtccgaagatgcgagtca
ctggagagaatcctccgttttctggaagatgagatgcaaaatgagattataatccaagtg
cctgacaaggatccagggacccctctgccccgggaaatgatcaccctggagactactctg
gagaagttggaaggagagctacaggaagccaaccagagccatcaggctttgaagaagagc
tttttggaactgacagagctcaaatacctcctgaagaaaacccaggacttttttgaggta
aacttagggttcacggccggtgtgataaacagggagaggatggcttccttcgagaggctg
ctgtggagagtttgccggggaaacgtatatttgaagttcagcgagatggacacacttctg
gaggatcctgtgacgaaagaagaaattaaaaagaatatattcatcatattttatcaagga
gaacagctcaggctgaaaatcaagaagatctgtgatgggtttcgtgctaccatctacccc
tgcccggagcatgcagccgagcgcagagagatgctggccagtgtcaatgtgaggctggaa
gacttaatcactgtcattacccaaacagagtctcaccgacagcgcctactgcaggaagca
gcttccaactggcactcgtgggtcatcaaagtacagaagatgaaggccgtctaccacgtg
ctgaacatgtgcaacatcgacgtcacccagcagtgcatcattgctgagatctggttccct
gtagcagacactagacacattaagaaggccctggagcaaggcatggaactcagtggctcc
tccatggtccccatcatgacagaagtggaaactaaaacagaccctcccaccttcaatagg
accaataaatttacagctggcttccagaacattgtcgatgcatatggtgtaggtagctac
cgagagataaacccagccccctatactatcatcaccttccccttcctgttcgctgtgatg
tttggagactgtggtcacgggatggtgatgctgatggccgccctgtggatggtcctaaat
gagagacacttgctggctcagaagagcaccaatgagatgtggaacatcttcttcaatggg
cgctatctgatcctcctcatgggcatcttctccatctacaccggcttgatctacaacgac
tgtttctccaaatcttttaacatctttggctcctcttggagtgtccagcctatgttcaga
aacggcacgtggaatgctcatgtcgtggaacagaatccgtatttgcagctggatccggcc
atcccaggagtgtattctggaaatccctacccatttgggattgatccgatttggaacctg
gcttcaaacaaactcacatttttaaactcctacaagatgaagatgtcggtcatcctggga
atcgttcatatgatcttcggtgttatcctcagcctcttcaatcacatctacttcagacga
accctcaacatcattctgcagttcatccccgagatgatttttatgctgagtctgtttgga
tacctggttttcatgatcattttcaagtggtgtcaatatgatgcccacacatcccagaag
gcacccagcatcctcatccacttcatcggcatgtttctgtttgactacgatgactcgtcc
aacgcacccctgtacggccatcagcaagaagtccagactttctttgtcattatagcgttg
gtgtctgtgccgtggatgcttttgattaagccatttatccttagagccaagcaccagaaa
tctcagctgcagtccttcacgatccatgaggatgccatggagggcccctctgttaagaag
actgcaggtgcccatgggacgaaggaaggacacgaggaggagttcaactttggagacatc
tttgtccaccaagccatccacaccattgagtactgcctgggctgcatctccaatacagcc
tcatatcttcggctgtgggctctcagcttggctcacgcagagctgtccgaggtactgtgg
accatggtgatgagcatcggccttcgcctccgaggctggggagggctcgttggtgtcttc
atcatttttgccgtcttcgccgtcctcacagttgccatcctcctcgttatggagggcctc
tcagcctttctgcacgccctccggctgcattgggtggaattccagaacaagttctacgag
ggggccggcttcaagttctcccccttctcctttaagcacgtcctggaaggggcggctgag
gagtag

KEGG   Rattus norvegicus (rat): 297566
Entry
297566            CDS       T01003                                 

Gene name
Atp6v1e1
Definition
(RefSeq) V-type proton ATPase subunit E 1
  KO
K02150  V-type H+-transporting ATPase subunit E
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    297566 (Atp6v1e1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    297566 (Atp6v1e1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    297566 (Atp6v1e1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    297566 (Atp6v1e1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    297566 (Atp6v1e1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    297566 (Atp6v1e1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    297566 (Atp6v1e1)
SSDB
Motif
Pfam: vATP-synt_E DUF4288 NifW
Other DBs
NCBI-GeneID: 297566
NCBI-ProteinID: NP_942040
RGD: 735157
Ensembl: ENSRNOG00000011905
UniProt: Q6PCU2
Position
4
AA seq 226 aa
MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKK
EKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLV
LQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKKDVDVQIDLEAYLPEDIAGG
VEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
NT seq 681 nt   +upstreamnt  +downstreamnt
atggcgctcagcgatgcagatgtacagaagcagattaagcacatgatggctttcatcgaa
caagaagccaatgagaaagcagaagaaatcgatgcaaaggcagaagaagagttcaacatt
gagaaaggtcgtcttgtgcaaacccagagattgaagattatggaatactatgagaagaag
gaaaagcagatcgagcagcagaagaaaattcaaatgtccaacttgatgaatcaagcaaga
ctcaaagtcctcagagcaagagatgacctcatcactgatctgctgaatgaggcaaaacag
agactcagcaaggtggtaaaagatacgaccaggtaccaggtgctgctggatgggctggtc
ctccagggcttgtaccagctgttggaacctcgaatgattgtgcgctgcagaaaacaagat
ttccctttggtgaaggctgcagtacagaaagcaatacctatgtataaaattgccaccaaa
aaagatgttgacgtccagattgacctggaggcctacctgcctgaggacatagctggtgga
gttgaaatctataatggggaccgcaagataaaggtttccaacactctggaaagccgactg
gacctaatagcccagcagatgatgccagaagtccgcggagccttgtttggtgcaaatgcc
aataggaagtttctggactga

KEGG   Rattus norvegicus (rat): 29757
Entry
29757             CDS       T01003                                 

Gene name
Atp6v0a1
Definition
(RefSeq) V-type proton ATPase 116 kDa subunit a1
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05152  Tuberculosis
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    29757 (Atp6v0a1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    29757 (Atp6v0a1)
   04142 Lysosome
    29757 (Atp6v0a1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    29757 (Atp6v0a1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    29757 (Atp6v0a1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    29757 (Atp6v0a1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    29757 (Atp6v0a1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    29757 (Atp6v0a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29757 (Atp6v0a1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   29757 (Atp6v0a1)
SSDB
Motif
Pfam: V_ATPase_I
Other DBs
NCBI-GeneID: 29757
NCBI-ProteinID: NP_113792
RGD: 68405
Ensembl: ENSRNOG00000036814
UniProt: P25286 Q2I6B5
Position
10
AA seq 838 aa
MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEE
MDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKR
NFLELTELKFILRKTQQFFDEMADPDLLEESSSLLEPNEMGRGAPLRLGFVAGVINRERI
PTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGF
RASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKM
KAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQT
PPTYNKTNKFTHGFQNIVDAYGIGTYREINPAPYTVITFPFLFAVMFGDFGHGILMTLFA
VWMVLRESRILSQKNENEMFSMVFSGRYIILLMGLFSIYTGLIYNDCFSKSLNIFGSSWS
VRPMFTIGNWTEETLLGSSVLQLNPAIPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKM
SVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMSSLFGYLVILIFYKWTAYDA
HSSRNAPSLLIHFINMFLFSYPESGNAMLYSGQKGIQCFLIVVAMLCVPWMLLFKPLILR
HQYLRKKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH
QAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLHVRSLAGGLGLFFIF
AAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYTGTGFKFLPFSFEHIREGKFDE
NT seq 2517 nt   +upstreamnt  +downstreamnt
atgggggagcttttccgaagcgaggagatgaccctggcccagctctttctccagtccgaa
gctgcttattgttgtgtcagtgaattaggagaacttggaaaggttcagttccgggattta
aatccagatgtgaatgttttccagaggaaatttgtgaatgaagttagaagatgtgaagaa
atggatcgaaaactccggtttgttgagaaagagataagaaaagctaacatcccaattatg
gacactggagagaacccggaggtgccctttcccagggacatgatcgacttggaggccaat
ttcgagaagatcgaaaacgaactgaaggaaatcaacactaaccaggaagctctaaagcga
aacttcctggaactgactgaattaaaatttatactgcgcaaaactcagcagtttttcgat
gagatggcggatccagacctgttggaagagtcctcatcactcttggagccaaacgagatg
ggaagaggcgcgcctttacgacttggcttcgtagctggtgtgattaaccgggaacggatc
ccgacctttgagcgcatgctttggcgagtgtgccgagggaatgtgttcctgagacaggct
gaaatcgaaaacccgctggaggatcccgtgactggcgactacgtgcacaagtccgtgttc
atcatttttttccaaggtgaccagctgaaaaacagggtcaagaaaatctgtgaagggttc
cgagcctccctctatccctgtcctgagactccacaggagagaaaagaaatggcttccgga
gtcaataccaggatcgacgatctccaaatggttctgaatcagacagaggaccaccgccag
agggttctgcaggcggctgctaagaacatccgggtgtggttcatcaaggtgcggaagatg
aaagctatctaccataccctgaacctctgcaacatcgatgtgacgcagaagtgcctgatc
gcggaagtctggtgccccgtcactgacctggactccatccagtttgcactgcgaaggggc
acggagcacagcggttccactgtcccctccattctgaacaggatgcagacaaaccagaca
cccccgacgtataacaaaaccaacaagttcacgcacggcttccagaacatagtggatgct
tatgggatcggcacttaccgagaaattaacccagctccgtacaccgtcatcaccttcccc
tttctgtttgctgtgatgtttggagattttgggcacggcattttgatgactctgtttgct
gtgtggatggtgttgagggagagccggatcctctcccagaagaacgagaatgagatgttt
agcatggtgttcagcggccgatacattatccttctgatgggactgttctccatctacact
ggactcatctacaatgactgcttttccaagtctctgaatatctttgggtcatcatggagc
gtacggccaatgttcaccatagggaactggacggaggagacgctcctggggagttctgtc
ctccagctgaacccagctatccctggagtctttggtggcccttacccatttggcattgat
ccgatttggaacatcgcaaccaacaagctgaccttcctcaactccttcaagatgaagatg
tcagttattcttgggatcatccacatgctgttcggggtcagcctgagccttttcaaccac
atctatttcaagaagcccctgaacatctactttggctttattcccgagataatcttcatg
tcctcgctgtttggctacctggtcatcctcatcttttacaagtggacagcctacgatgcc
cactcgtctagaaatgccccgagcctcctgatccatttcataaacatgttcctcttctcc
tacccagagtctggtaacgcaatgctgtactctggacagaaaggaattcagtgtttcctc
atagtggtggcaatgctctgtgtcccctggatgctgctgtttaagccgttgatccttcgc
catcagtacctgaggaagaagcatttgggaactctcaactttggtgggatcagggtgggc
aacggaccgacagaggaggatgctgaaattattcagcatgaccagctctccacccattca
gaggacgcagaagagcctaccgaggacgaagtgtttgactttggcgacaccatggtccac
caggccatccacaccattgagtactgcttgggctgcatctccaacactgcgtcctacctg
cggctctgggccctcagcctggcccatgcacagctctctgaagtactctggaccatggtg
atccacatcggcctgcatgtccggagtctggcagggggactggggctgtttttcatcttc
gctgcctttgccaccctgaccgtggccatcctgctgatcatggaaggcctctcagccttc
ctccacgcactgcgattacactgggtggaattccagaacaaattctacactgggactggt
ttcaagttcctccccttctcctttgagcacattcgggaagggaagtttgatgagtga

KEGG   Rattus norvegicus (rat): 297797
Entry
297797            CDS       T01003                                 

Gene name
Atp6v1h
Definition
(RefSeq) V-type proton ATPase subunit H
  KO
K02144  V-type H+-transporting ATPase subunit H
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno05152  Tuberculosis
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    297797 (Atp6v1h)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    297797 (Atp6v1h)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    297797 (Atp6v1h)
   04142 Lysosome
    297797 (Atp6v1h)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    297797 (Atp6v1h)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    297797 (Atp6v1h)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    297797 (Atp6v1h)
  09163 Immune disease
   05323 Rheumatoid arthritis
    297797 (Atp6v1h)
SSDB
Motif
Pfam: V-ATPase_H_N V-ATPase_H_C Arm Arm_2 HEAT DUF2326 DUF87
Other DBs
NCBI-GeneID: 297797
NCBI-ProteinID: NP_001013951
RGD: 1562450
Ensembl: ENSRNOG00000030862
UniProt: Q5XIL1
Position
5
AA seq 441 aa
MTKMDIRGAVDAAVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRCSE
EKQEMLQTEGSQCAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKS
TAWPYFLPMLNRQDPFTVHMAARIIAKLAAWGKELMEGSDLNYYFNWIKTQLSSQKLRGS
GVAVETGTISASDSSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCIMGVLSNKCGFQLQ
YQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEKVTRIILAAFRNFLEKSTERE
TRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKFGESVQDLRILTKLLEVSD
DPQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVH
NWEYLGKQLQSEQPQTAAARS
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgaccaagatggacattcgaggtgccgtggatgctgctgtcccaactaacatcattgca
gccaaggctgctgaagttcgtgccaacaaagtgaactggcagtcctatcttcaggggcag
atgatttctgctgaagattgtgaatttattcaaaggttcgaaatgaagagatgttctgag
gagaagcaagagatgcttcaaactgaaggcagccagtgtgctaaaacgtttataaatctg
atgacacacatctccaaagaacagacagtgcagtacatactgaccatggtcgacgacatg
ctgcaggaaaatcaccagcgtgtcagcattttctttgactatgcaaaacgaagcaagagc
actgcctggccatactttctgccaatgttgaatcgccaggacccctttactgttcatatg
gcagcaagaattattgccaagttagcagcctggggaaaggaactcatggaaggcagtgac
ttaaattactacttcaattggataaaaactcagttgagttcacagaaacttcgtggtagc
ggtgttgctgttgaaacaggaacaatctctgcgagcgatagttctcagtatgtgcagtgt
gttgctggctgtctgcagctgatgctccgggtcaatgagtaccgttttgcctgggtggaa
gcagatggggtgaactgtataatgggcgttttgagtaacaagtgtggttttcaacttcaa
tatcaaatgattttttcaatatggcttctggcattcagtcctcaaatgtgtgaacacctt
cgtcgctataacatcattcctgttctgtcagacatccttcaagaatctgtcaaagagaaa
gtaacaagaatcattcttgcagcattccgtaatttcttagaaaaatcaacggaaagagaa
actcgccaagagtatgctctggctatgattcaatgcaaagtcctaaaacagttggagaat
ttggagcagcagaagtatgatgatgaagatatcagtgaagacatcaaatttcttttggaa
aaatttggtgagagtgtccaggaccttagaatcttgacaaaacttctggaggtatcagat
gatccacaagttttagctgttgctgctcatgatgttggagaatatgtccggcattatccc
cggggcaaacgggttattgagcagctcggtgggaagcagctggtgatgaaccacatgcac
catgaagaccagcaggtccgctacaatgctcttctggctgtgcagaagctcatggtgcac
aactgggagtatcttggtaaacagctccagtcggagcagccccagactgctgctgctcga
agctga

KEGG   Rattus norvegicus (rat): 297932
Entry
297932            CDS       T01003                                 

Gene name
Atp6v0d2
Definition
(RefSeq) V-type proton ATPase subunit d 2
  KO
K02146  V-type H+-transporting ATPase subunit d
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05152  Tuberculosis
rno05165  Human papillomavirus infection
rno05203  Viral carcinogenesis
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    297932 (Atp6v0d2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    297932 (Atp6v0d2)
   04142 Lysosome
    297932 (Atp6v0d2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    297932 (Atp6v0d2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    297932 (Atp6v0d2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    297932 (Atp6v0d2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    297932 (Atp6v0d2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    297932 (Atp6v0d2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    297932 (Atp6v0d2)
SSDB
Motif
Pfam: vATP-synt_AC39
Other DBs
NCBI-GeneID: 297932
NCBI-ProteinID: NP_001011972
RGD: 1306900
Ensembl: ENSRNOG00000006926
UniProt: Q5FVL0
Position
5
AA seq 350 aa
MLETAELYFNVDHGYLEGLVRGCKASLLTQQDYVNLVQCETLEDLKIHLQTTDYGNFLAH
ETNPLTVSKIDTEMRKKLCREFDYFRNHSLEPLSTFFTYMTCSYMIDNIILLMNGALQKK
SVKEVLAKCHPLGRFTEMEAVNIAESASELFKAVLVETPLAPFFQDCMSENTLDELNIEL
LRNKLYKSYLEAFYKFCKDHGDVTAEVMCPILEFEADRRALIITLNSFGTELSKEDRETL
FPTCGKLYPEGLRLLAQAEDFEHMKRVADNYGVYKPLFDAVGGSGGKTLEDVFYEREVQM
NVLAFNRQFHYGVFYAYVKLKEQEMRNIVWIAECISQRHRTKINSYIPIL
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgcttgagacggcagagctgtacttcaatgtggaccatggctacctggagggcctggtg
cgagggtgcaaagccagcctcctaactcagcaggactatgtcaacttagtgcagtgtgag
accttggaagatttgaaaattcatctccagaccactgactatggcaacttcctggctcat
gaaacaaaccctctcactgtttccaaaattgacacggagatgaggaagaagctatgcaga
gagtttgactatttccgaaatcattccttggagcccctcagcacatttttcacctacatg
acgtgcagctatatgatagacaacataattctactgatgaatggggcattgcaaaagaaa
tccgtgaaagaagttctagccaagtgtcacccattgggccgcttcactgaaatggaagcc
gtcaacattgcagagagcgcctcagagctcttcaaggctgtgctggttgaaacaccatta
gctccattcttccaagattgtatgtctgaaaatactcttgatgaactgaatattgaatta
ctgcgcaataaactatacaagtcttacctcgaggcattctacaaattctgcaaggatcac
ggtgatgtcacagcagaagttatgtgtcccattcttgagtttgaggccgacagacgcgct
ttaatcatcactctgaactcatttggcactgaactgagcaaagaagacagggagaccctc
ttccccacctgcggcaagctctatccggagggactgcggctgttagcccaagccgaagac
ttcgagcacatgaagagagtggcagataattacggagtttacaagcctttgtttgacgcc
gtaggtggcagtgggggaaagacactggaagatgttttctatgagcgagaggtacagatg
aatgtgctggcgttcaacaggcaattccactatggtgtgttttatgcctatgtaaagttg
aaggagcaggagatgagaaatatcgtgtggatagcagaatgcatctcacagcgacatcga
actaaaatcaacagctacattccaattttataa

KEGG   Rattus norvegicus (rat): 298103
Entry
298103            CDS       T01003                                 

Gene name
Atp6v1g1
Definition
(RefSeq) V-type proton ATPase subunit G 1
  KO
K02152  V-type H+-transporting ATPase subunit G
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    298103 (Atp6v1g1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    298103 (Atp6v1g1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    298103 (Atp6v1g1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    298103 (Atp6v1g1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    298103 (Atp6v1g1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    298103 (Atp6v1g1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    298103 (Atp6v1g1)
SSDB
Motif
Pfam: V-ATPase_G FdhE DUF6080 CSRNP_N CDC14 RNase_Y_N DUF2164 MPM1
Other DBs
NCBI-GeneID: 298103
NCBI-ProteinID: NP_001100130
RGD: 1310088
Ensembl: ENSRNOG00000008163
UniProt: B2GUV5
Position
5
AA seq 118 aa
MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEA
AALGSHGSCSSEVEKETQEKMTILQNYFEQNRDEVLDNLLAFVCDIRPEIHENYRING
NT seq 357 nt   +upstreamnt  +downstreamnt
atggcgagtcagtcgcagggcatccagcagctactgcaggctgagaagcgggcggccgag
aaggtgtccgaggcccgcaagcgaaagaaccggagactgaagcaggccaaagaagaagcc
caggctgaaattgaacagtaccgtctgcagagggagaaggagttcaaggccaaggaagct
gcggcattggggtcccatggcagttgtagcagtgaggtggaaaaggagacccaggagaag
atgaccatcctccagaactactttgagcagaacagagatgaagtcctggataacctcttg
gcctttgtgtgtgacatccggccagaaatccatgaaaactaccgcataaatggatag

KEGG   Rattus norvegicus (rat): 298451
Entry
298451            CDS       T01003                                 

Gene name
Atp6v0b
Definition
(RefSeq) V-type proton ATPase 21 kDa proteolipid subunit
  KO
K03661  V-type H+-transporting ATPase 21kDa proteolipid subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno05152  Tuberculosis
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    298451 (Atp6v0b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    298451 (Atp6v0b)
   04142 Lysosome
    298451 (Atp6v0b)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    298451 (Atp6v0b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    298451 (Atp6v0b)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    298451 (Atp6v0b)
  09163 Immune disease
   05323 Rheumatoid arthritis
    298451 (Atp6v0b)
SSDB
Motif
Pfam: ATP-synt_C DUF819
Other DBs
NCBI-GeneID: 298451
NCBI-ProteinID: NP_001100151
RGD: 1308303
Position
5
AA seq 100 aa
MPSNNLFCPSQPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALA
DAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD
NT seq 303 nt   +upstreamnt  +downstreamnt
atgccttctaacaacttattctgcccctcacagcctttcagtgctactgaccccaaggcc
attggccatcgaaactaccacgcaggctactccatgtttggggctggcctcacagtcggt
ctgtccaacctgttctgtggagtctgcgtgggcattgtgggcagtggggctgccctggct
gacgcacagaaccccagcctctttgtaaaaattctcatcgtggagatctttggcagtgcc
attggcctctttggggtcatcgtcgcaatccttcagacctccagagtgaagatgggtgac
tag

KEGG   Rattus norvegicus (rat): 299159
Entry
299159            CDS       T01003                                 

Gene name
Atp6v1d
Definition
(RefSeq) V-type proton ATPase subunit D
  KO
K02149  V-type H+-transporting ATPase subunit D
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    299159 (Atp6v1d)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    299159 (Atp6v1d)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    299159 (Atp6v1d)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    299159 (Atp6v1d)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    299159 (Atp6v1d)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    299159 (Atp6v1d)
  09163 Immune disease
   05323 Rheumatoid arthritis
    299159 (Atp6v1d)
SSDB
Motif
Pfam: ATP-synt_D
Other DBs
NCBI-GeneID: 299159
NCBI-ProteinID: NP_955418
RGD: 735119
Ensembl: ENSRNOG00000009080
UniProt: Q6P503
Position
6
AA seq 247 aa
MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGE
VMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYE
LTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRI
ERTLAYIITELDEREREEFYRLKKIQEKKKIIKEKSEKDLERRRAAGEVMEPANLLAEEK
DEDLLFE
NT seq 744 nt   +upstreamnt  +downstreamnt
atgtcgggcaaagaccggattgaaatcttcccttcgcgaatggcacagaccatcatgaag
gctcggttaaaaggagcacagactggtcgaaacctcctgaagaaaaagtctgatgcctta
actcttcgatttcgacagatcctgaagaagataatagagactaagatgctgatgggtgag
gtgatgagagaagctgccttctcattggctgaggccaaattcacagcaggggacttcagc
accacagttatacaaaatgtaaataaagcccaggtgaagatccgagcaaagaaagacaat
gtagcaggtgtcaccttaccagtgtttgaacattaccacgaaggaactgacagctatgaa
ctaaccggtttagccagaggtggggagcagctggcgaaacttaagcggaattatgccaaa
gcagtggaactactggtggaactggcttccctgcagacttcctttgttactctggatgaa
gccattaagataaccaacaggcgtgtaaatgctattgagcatgtcatcattccccggatt
gaacgcacccttgcttatatcatcacagaactggatgagagagagcgagaagaattctat
aggttaaagaaaatccaggagaagaaaaagattatcaaggagaaaagcgagaaggacttg
gagcggcggagagcagctggagaggtgatggagcccgccaacctcctggcggaagagaag
gacgaggacctgctgttcgagtag

KEGG   Rattus norvegicus (rat): 299971
Entry
299971            CDS       T01003                                 

Gene name
Atp6v1c1
Definition
(RefSeq) V-type proton ATPase subunit C 1
  KO
K02148  V-type H+-transporting ATPase subunit C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    299971 (Atp6v1c1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    299971 (Atp6v1c1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    299971 (Atp6v1c1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    299971 (Atp6v1c1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    299971 (Atp6v1c1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    299971 (Atp6v1c1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    299971 (Atp6v1c1)
SSDB
Motif
Pfam: V-ATPase_C MP NRIP1_repr_1 Folliculin
Other DBs
NCBI-GeneID: 299971
NCBI-ProteinID: NP_001011992
RGD: 1311082
Ensembl: ENSRNOG00000004846
UniProt: Q5FVI6
Position
7
AA seq 382 aa
MTEFWLISAPGEKTCQQTWEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELAK
LDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLKN
ISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSE
YLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFKKAVDDFRHK
ARENKFIVRDFQYNEEEMRADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKAL
RVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDSSAAAIIDAPMDIPGLN
LSQQEYYPYVYYKIDCNLLEFK
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgactgagttctggctgatatctgctcctggggagaaaacctgtcagcaaacatgggag
aaactacatgcagcgaccaccaagaacaataaccttgctgtctcttccaagttcaacatt
cctgacttaaaggttggcacgttggatgtcttggttggcttgtcggatgaactggctaaa
ctggatgcatttgtagaaggggtggtcaagaaagtggctcagtacatggctgatgtgctg
gaggacagcaaagataaagttcaggagaacttgctggccagtggagttgacttggtcact
tacataacaaggttccagtgggatatggccaaatatccaatcaagcagtctctgaaaaat
atctctgaaataattgccaagggagtgactcagattgataatgacctaaagtctcgggcg
tctgcatacaataacctgaaagggaatcttcagaatttggagcgaaagaatgcgggaagt
ttactaactcgaagcctggcggaaattgtgaagaaagatgactttgttcttgattcggag
tatcttgtcacattattggtggtagttcccaagttgaaccacaatgactggattaagcag
tatgaaacacttgcagaaatggtagtaccaaggtcgagcaatgttctttcagaggaccaa
gacagttatctttgtaacgtcaccttgtttaaaaaagcagttgatgatttcagacacaaa
gccagagaaaacaagttcatcgtccgtgacttccagtataacgaggaggagatgagagcc
gacaaagaggagatgaaccggctgtccactgacaagaagaagcagtttggaccacttgtg
cggtggcttaaagtgaatttcagtgaggcctttattgcgtggattcatataaaagcatta
cgggtttttgtggagtctgttttaaggtatggcttgccggtgaacttccaagcaatgctc
cttcaacctaataagaaatcagtgaagaagctaagagaagtgttgcatgagttgtacaag
catctggacagcagtgcagctgccatcattgatgctcctatggatattcctggcctgaac
ctgagtcagcaagaatactacccctatgtgtactacaagattgattgcaacttgctggaa
ttcaagtaa

KEGG   Rattus norvegicus (rat): 312488
Entry
312488            CDS       T01003                                 

Gene name
Atp6v1b1
Definition
(RefSeq) V-type proton ATPase subunit B, kidney isoform
  KO
K02147  V-type H+-transporting ATPase subunit B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    312488 (Atp6v1b1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    312488 (Atp6v1b1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    312488 (Atp6v1b1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    312488 (Atp6v1b1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    312488 (Atp6v1b1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    312488 (Atp6v1b1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    312488 (Atp6v1b1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    312488 (Atp6v1b1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   312488 (Atp6v1b1)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N
Other DBs
NCBI-GeneID: 312488
NCBI-ProteinID: NP_001101337
RGD: 1310619
Ensembl: ENSRNOG00000013573
Position
4
AA seq 513 aa
MATQVDGRPSGFTSNSCDPGTAREHVQVVTRNYITHPRVTYRTVCSVNGPLVVLDQVKFA
QYAEIVNFTLPDGTQRSGQVLEVAGTKAIVQVFEGTSGIDSQKTTCEFTGDILRTPVSED
MLGRIFNGSGKPIDKGPAVMAEDFLDINGQPINPHDRIYPEEMIQTGISPIDVMNSIARG
QKIPIFSAAGLPHNEIAAQICRQAGLVKKSKAVLDYHEDNFAIVFAAMGVNMETARFFKS
DFEQNGTMGNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEA
LREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRGGSITQIPILTMPNDDITHPIP
DLTGFITEGQIYVDRQLHNRQVYPPINVLPSLSRLMKSAIGEGMTRKDHGDVSNQLYACY
AIGKDVQAMKAVVGEEALTSEDLLYLEFLQKFEKNFINQGPYENRTVFESLDLGWKLLRI
FPKEMLKRIPQSVTDEFYSRQGAQQDPASDTAL
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggccacacaagtagacggcaggccctcgggattcactagcaatagctgcgacccaggc
acagcccgagagcatgtgcaggttgtgacccgaaactacatcacccacccccgtgtcacc
tacaggacagtatgcagcgtcaatgggcctctggtggtgctggaccaagtcaagtttgcc
cagtacgctgagattgtcaactttaccctccctgatggtactcagaggagtggccaagtg
cttgaagtggctgggaccaaagccattgttcaggtgtttgaggggacctcagggatcgat
tcccagaagaccacatgtgaattcacaggcgacatcctgcggactccagtgtcagaggac
atgctgggtcggattttcaatggctctggcaaacccattgacaaaggacctgctgtcatg
gcagaggactttctggacatcaatggccagccaatcaatccccatgaccgaatctaccct
gaggagatgatccagacgggaatctcccccatcgatgtcatgaacagcatcgcccgtggc
cagaagattcccatcttctctgcagcggggctcccccacaatgagattgcagcccagatc
tgccgccaagctgggctggtgaagaaatccaaggctgtgctggattatcatgaagacaac
ttcgccattgtctttgcagccatgggggtgaacatggagacagccaggttcttcaagtca
gatttcgagcagaatggaaccatggggaatgtctgtctcttcctgaatttggccaatgac
cctacgattgagcggatcatcaccccacgtctggcactgaccacagctgagttccttgcc
taccagtgtgagaagcatgtgctggtcatattgactgacatgagctcctatgcggaagct
ttgcgggaggtctcagctgcccgagaggaagtaccaggacgccgtggcttccccggatat
atgtacacagacttggccaccatctatgagcgagccggccgtgtggagggccggggtggc
tccataacccagatccccattctcactatgcctaatgacgatattacccaccccatccca
gacctgactggcttcatcacagagggacagatttatgtggacagacagctacataaccgg
caggtctacccacccatcaatgtgctcccttccctctcacgactgatgaagtcggccata
ggtgagggcatgaccagaaaggaccacggagatgtctccaaccagctgtacgcctgctac
gccatcgggaaggacgtgcaggccatgaaagcggtggtgggggaggaggcgctcacctcc
gaggacctgctctacctggagttcctgcagaagttcgagaagaatttcatcaaccaaggt
ccctacgagaaccgcacagtgttcgagtcgctggacctgggctggaaactgctgcgcatc
tttcctaaagagatgctgaagcgcattccgcagagcgtgacggacgagttctactctcgc
cagggggcgcagcaggaccccgcatccgacacggcgctctaa

KEGG   Rattus norvegicus (rat): 362802
Entry
362802            CDS       T01003                                 

Gene name
Atp6v1c2
Definition
(RefSeq) V-type proton ATPase subunit C 2
  KO
K02148  V-type H+-transporting ATPase subunit C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    362802 (Atp6v1c2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    362802 (Atp6v1c2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    362802 (Atp6v1c2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    362802 (Atp6v1c2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    362802 (Atp6v1c2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    362802 (Atp6v1c2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    362802 (Atp6v1c2)
SSDB
Motif
Pfam: V-ATPase_C
Other DBs
NCBI-GeneID: 362802
NCBI-ProteinID: NP_001014221
RGD: 1359430
Ensembl: ENSRNOG00000050553
UniProt: Q6AYE4
Position
6
AA seq 425 aa
MSEFWLISAPGDKENLQALERMNSVTSKSNLSHNTKFAIPDFKVGTLDSLVGLSDELGKL
DTFAESLIKRMAQSVVEVMEDSKGKVHENLLANGVDLTSFVTHFEWDMAKYPAKQPLVSV
VDTLAKQLAQIETDLKSRTAAYSVLKANLENLEKKSTGNLFTRTLSDIVSKEDFVLDSEY
LITLLVIVPKSSYVQWQKTYESLSDMVVPRSTKLIAEDNEGGLFTVTLFRKVIEDFKVKA
KENKFIVREFYYDEKEIKREREEMTRLLSDKKQQYQTSCVALKKGSATYRDHKVKVTPLG
NPTRPTAGQNDRESEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQ
AVLLQPHKKSATKRLREVLNSVFRHLDEVAAASILDASVEIPGLQLSNQDYFPYVYFHID
LSLLD
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtccgagttttggcttatttcggcccctggcgataaggaaaatttacaagctctggag
aggatgaacagcgtaacttcaaagtctaacctgtcccacaacactaaatttgccatccca
gacttcaaggtggggaccttggattcccttgttggtctctctgatgagttggggaaactc
gatacctttgctgaaagcctcataaagagaatggcacagagtgtggtggaggtcatggaa
gactccaagggaaaagtacacgagaacctcctggctaatggagttgacctgacatccttt
gtgacacacttcgagtgggacatggccaaatatcctgccaagcagccactggtgagcgtg
gtggatacactggccaagcaactggcacaaatcgagacagacctgaagtcgcgaacagcc
gcctacagtgttctgaaggccaacctggagaacttggagaagaaatccacggggaacctc
ttcactcggacactgagtgatattgtcagcaaggaagacttcgtactcgattctgaatat
ctcataaccctgctggtcatcgtccccaagtcaagctatgtacagtggcagaagacatat
gagtccctatcggacatggtggtccctcggtcaaccaaattgatcgctgaggacaatgaa
ggtggtctcttcacagtgactcttttccgaaaagtgattgaagacttcaaagtcaaagcc
aaagaaaacaagttcattgtccgggaattttactatgatgagaaagaaattaaaagagag
agggaagagatgaccaggttgctgtctgataagaaacaacagtatcaaacttcctgtgtt
gctcttaaaaagggatcagccacctaccgtgaccacaaggttaaggtaaccccgctaggt
aaccctactaggcctactgcggggcagaacgacagagagagtgagggcgagggtgaggga
cctctgctgcgctggctcaaggtgaacttcagcgaggcctttattgcctggatccacata
aaggccctgagagtgtttgtggagtctgtgctcaggtatggacttccagtgaacttccag
gctgtgctcctgcagccccataaaaagtctgccaccaaacgcctgagagaggtgctcaat
tcggtcttccggcacctggatgaagttgctgcagcaagcatactggatgcatccgtggag
atccctggcctgcagctcagcaaccaggactatttcccctacgtgtacttccacatcgac
ctcagccttcttgactag

KEGG   Rattus norvegicus (rat): 366545
Entry
366545            CDS       T01003                                 

Gene name
Atp6v1e2
Definition
(RefSeq) V-type proton ATPase subunit E 2
  KO
K02150  V-type H+-transporting ATPase subunit E
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    366545 (Atp6v1e2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    366545 (Atp6v1e2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    366545 (Atp6v1e2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    366545 (Atp6v1e2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    366545 (Atp6v1e2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    366545 (Atp6v1e2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    366545 (Atp6v1e2)
SSDB
Motif
Pfam: vATP-synt_E DUF4288 Folliculin
Other DBs
NCBI-GeneID: 366545
NCBI-ProteinID: NP_001102449
RGD: 1311680
Ensembl: ENSRNOG00000015566
UniProt: D3ZJ78
Position
6
AA seq 226 aa
MALTDIDVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMDYFEKK
EKQIEQQKKIQLSTMRNQARITVLRARDNLILELLKEAKMRLSRIVSDEEFYQDLLDKLV
LQALLRLLEPVMIVRCREQDFYLVQSALLRAIPQYMMLCQKHLEVQIDQTEYLSSNAAGG
VEVYSSDRKIKVSNTLESRLNLAALQNMPEIRRTLFGDNSNRKFFT
NT seq 681 nt   +upstreamnt  +downstreamnt
atggccctgactgacatagatgtgcagaaacagatcaagcacatgatggcattcatcgag
caggaagccaatgagaaggcggaggagatagacgccaaggcagaggaagagttcaacatt
gagaaaggccgcctggtgcagacccagcggctgaagatcatggattattttgagaagaag
gagaaacagatagagcagcagaaaaaaatccagctgtccaccatgagaaaccaggctcgg
atcacagtcctgagagcccgagacaatctcatcttggaactgctcaaagaggcgaagatg
aggctcagtagaatcgtgtcggatgaagagttctaccaagatctgctggataagctcgtg
ctccaagctttgctccggctgctggagccggtgatgattgtccgatgcagagaacaggac
ttctacctggtgcagtctgccctgctaagagccatccctcagtacatgatgctctgccag
aagcatttggaggtccagattgatcaaactgaatacttgtcttccaatgctgccggaggg
gtggaggtctatagcagcgatcggaaaataaaggtttccaataccctagaaagccgactg
aatctcgcagccctgcagaatatgccagagatacgaaggactttgtttggggataattct
aacaggaagttctttacatga

KEGG   Rattus norvegicus (rat): 368044
Entry
368044            CDS       T01003                                 

Gene name
Atp6v1g2
Definition
(RefSeq) V-type proton ATPase subunit G 2
  KO
K02152  V-type H+-transporting ATPase subunit G
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    368044 (Atp6v1g2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    368044 (Atp6v1g2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    368044 (Atp6v1g2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    368044 (Atp6v1g2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    368044 (Atp6v1g2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    368044 (Atp6v1g2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    368044 (Atp6v1g2)
SSDB
Motif
Pfam: V-ATPase_G Zein-binding Borrelia_P83
Other DBs
NCBI-GeneID: 368044
NCBI-ProteinID: NP_997655
RGD: 1303186
Ensembl: ENSRNOG00000000840
Vega: OTTRNOG00000001725
UniProt: Q8R2H0
Position
20
AA seq 118 aa
MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREQEFQSKQQ
AAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLTQLLGMVCDVRPQVHPNYRITV
NT seq 357 nt   +upstreamnt  +downstreamnt
atggccagtcagtcccagggtatccagcagctcctccaggctgagaagcgggcagcggag
aaggtggccgatgccaggaagaggaaggcccggcgactgaagcaggcgaaggaggaggct
caaatggaggtggagcaataccgcagggagcgagagcaggagttccagagcaagcagcag
gcggccatgggctctcaggggaacctgtctgctgaggtggagcaggccacgagacgtcag
gttcagggcatgcagagctcccagcagagaaatcgggagcgagtcctgactcagcttctt
ggcatggtctgtgacgtcagaccccaggtccaccccaactatcggattactgtctag

KEGG   Rattus norvegicus (rat): 436582
Entry
436582            CDS       T01003                                 

Gene name
Atp6v0e2
Definition
(RefSeq) V-type proton ATPase subunit e 2
  KO
K02153  V-type H+-transporting ATPase subunit e
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    436582 (Atp6v0e2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    436582 (Atp6v0e2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    436582 (Atp6v0e2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    436582 (Atp6v0e2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    436582 (Atp6v0e2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    436582 (Atp6v0e2)
SSDB
Motif
Pfam: ATP_synt_H DrsE_2 Far-17a_AIG1
Other DBs
NCBI-GeneID: 436582
NCBI-ProteinID: NP_001002253
RGD: 1303238
Ensembl: ENSRNOG00000008218
UniProt: Q5EB76
Position
4
AA seq 81 aa
MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQL
NPLFGPQLKNETIWYVRFLWE
NT seq 246 nt   +upstreamnt  +downstreamnt
atgacagcccattcctttgcccttcctgtcatcatcttcaccacattctggggcctcatc
ggcatcgctgggccctggttcgtgcccaaaggacccaaccgtggggtgatcatcaccatg
ctggtagctactgctgtctgctgttacctcttctggctcatcgccatcttggcccagctg
aaccccctatttgggccacagctgaagaatgagaccatctggtacgtgcgcttcctgtgg
gagtga

KEGG   Rattus norvegicus (rat): 685232
Entry
685232            CDS       T01003                                 

Gene name
Atp6v1a
Definition
(RefSeq) V-type proton ATPase catalytic subunit A
  KO
K02145  V-type H+-transporting ATPase subunit A [EC:7.1.2.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    685232 (Atp6v1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    685232 (Atp6v1a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    685232 (Atp6v1a)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    685232 (Atp6v1a)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    685232 (Atp6v1a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    685232 (Atp6v1a)
  09163 Immune disease
   05323 Rheumatoid arthritis
    685232 (Atp6v1a)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     685232 (Atp6v1a)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_Xtn ATP-synt_ab_N
Other DBs
NCBI-GeneID: 685232
NCBI-ProteinID: NP_001101788
RGD: 1596464
Ensembl: ENSRNOG00000001992
UniProt: D4A133
Position
11
AA seq 617 aa
MDFSKLPKIRDEDKESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGD
MATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR
GVNVSALSRDIKWEFIPSKNLRVGSHITGGDIYGIVNENSLIKHKIMLPPRSRGSVTYIA
PPGNYDASDVVLELEFEGVKEKLSMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPC
VQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDG
KVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADSTSRWAEALRE
ISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPEREGSVSIVGAVSPPGGDFSDP
VTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAK
EILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGM
LSNMISFYDMARRAVETTAQSDNKITWSIIREHMGEILYKLSSMKFKDPVKDGEAKIKAD
YAQLLEDMQNAFRSLED
NT seq 1854 nt   +upstreamnt  +downstreamnt
atggatttctccaagctacccaaaatccgtgatgaagacaaagaaagcacatttggttat
gtgcatggagtctcagggcctgtggtcaccgcctgtgacatggcgggcgctgccatgtac
gagctggtgagagtggggcacagcgagctggtcggagagattatccgactggaaggtgac
atggccaccattcaggtgtacgaggaaacttctggtgtctctgttggagaccctgtactc
cgcactggtaaacctctctcggtagaacttggtcctggcattatgggagccatttttgat
ggtattcagagacctctatcggatatcagcagtcagacccaaagtatctacatccccaga
ggagtaaatgtgtctgctcttagcagagatatcaaatgggagtttatacccagcaaaaac
ctacgggttggtagtcatatcactggtggagatatttatgggattgtcaatgagaactcg
ctcatcaaacacaaaatcatgctacccccacgcagccgaggaagtgtgacttacatcgca
ccgcctgggaactacgatgcctctgatgtcgtcctggagcttgaatttgaaggtgtgaag
gagaagttgagcatggtccaagtgtggcctgtgcgtcaggtgcggcctgtcactgaaaag
ctgccagccaaccaccccttgcttactggccagagagtgctcgatgcccttttcccgtgt
gttcagggaggaactactgctattccaggtgcttttggctgtgggaagactgtgatttcc
cagtctctatccaagtactccaacagcgatgtgattatctatgtcggctgcggtgaaaga
gggaatgagatgtcagaagttctccgggacttccctgagctcactatggaagttgatggt
aaagtagagtccatcatgaagaggacagcgctggtagccaatacctccaatatgcctgtg
gctgcaagagaggcctccatttacactggaattacactatcagaatacttccgtgacatg
gggtaccacgtcagtatgatggctgactctacctctagatgggctgaggccctcagagaa
atctctggtcgcttagctgaaatgcctgcagatagtggataccctgcataccttggtgcc
cgactggcttctttctatgagcgagcaggcagagtgaaatgtcttggaaaccctgagaga
gaagggagtgtcagcattgtaggagcagtttctccacctggtggtgatttttctgatcca
gtcacatctgctactctgggtattgttcaggtgttctggggcttggataagaagctagct
cagcgcaagcacttcccgtccgtcaactggctcattagctacagcaagtacatgcgcgcc
ctggacgagtactatgacaaacacttcacagagttcgtgcctctgaggaccaaagctaag
gagattctgcaggaagaggaggatctggcggaaatcgtgcagctcgtgggaaaggcgtct
ttagcagagacagataaaatcaccctggaggtagcaaaacttatcaaagatgacttccta
caacaaaatgggtacactccttatgacaggttctgtccattctataagacggtggggatg
ctgtccaacatgatttcattctatgatatggcccgccgggctgtggagaccaccgcccag
agtgacaataagatcacatggtccattatccgtgagcacatgggggagattctctataaa
ctttcctccatgaaattcaaggatccagtgaaggatggcgaggcaaagatcaaggccgac
tacgcacagcttcttgaagatatgcagaacgcattccgtagcctggaagattag

KEGG   Rattus norvegicus (rat): 94170
Entry
94170             CDS       T01003                                 

Gene name
Atp6v0e1
Definition
(RefSeq) V-type proton ATPase subunit e 1
  KO
K02153  V-type H+-transporting ATPase subunit e
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    94170 (Atp6v0e1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    94170 (Atp6v0e1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    94170 (Atp6v0e1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    94170 (Atp6v0e1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    94170 (Atp6v0e1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    94170 (Atp6v0e1)
SSDB
Motif
Pfam: ATP_synt_H
Other DBs
NCBI-GeneID: 94170
NCBI-ProteinID: NP_446030
RGD: 621393
Ensembl: ENSRNOG00000003269
UniProt: Q794C0
Position
10
AA seq 81 aa
MAYHGLTVPLIVMSVFWGFVGLLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQL
NPLFGPQLKNETIWYLKYHWP
NT seq 246 nt   +upstreamnt  +downstreamnt
atggcataccacggcctcactgtgcctttgatcgtgatgagcgtgttctggggcttcgtg
ggcctcctcgtgccctggtttatccccaagggtcctaaccggggagttatcatcaccatg
ttggtgacctgttccgtttgctgctatctcttttggctgattgcgattctggcgcagctc
aatcctctgtttggaccacagttgaaaaatgaaaccatctggtatctgaagtatcactgg
ccttga

DBGET integrated database retrieval system