KEGG   Rattus norvegicus (rat): 116465
Entry
116465            CDS       T01003                                 

Gene name
Ifngr1
Definition
(RefSeq) interferon gamma receptor 1 precursor
  KO
K05132  interferon gamma receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04066  HIF-1 signaling pathway
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05164  Influenza A
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05200  Pathways in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    116465 (Ifngr1)
   04066 HIF-1 signaling pathway
    116465 (Ifngr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    116465 (Ifngr1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    116465 (Ifngr1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    116465 (Ifngr1)
   04658 Th1 and Th2 cell differentiation
    116465 (Ifngr1)
   04659 Th17 cell differentiation
    116465 (Ifngr1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    116465 (Ifngr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116465 (Ifngr1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    116465 (Ifngr1)
  09172 Infectious disease: viral
   05164 Influenza A
    116465 (Ifngr1)
   05168 Herpes simplex virus 1 infection
    116465 (Ifngr1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    116465 (Ifngr1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    116465 (Ifngr1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    116465 (Ifngr1)
   05140 Leishmaniasis
    116465 (Ifngr1)
   05142 Chagas disease
    116465 (Ifngr1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    116465 (Ifngr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    116465 (Ifngr1)
   04090 CD molecules [BR:rno04090]
    116465 (Ifngr1)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IFN receptor family
   116465 (Ifngr1)
CD molecules [BR:rno04090]
 Proteins
  116465 (Ifngr1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 116465
NCBI-ProteinID: NP_446235
RGD: 620570
Ensembl: ENSRNOG00000012074
UniProt: Q6P6T3 Q9QZ62
Position
1
AA seq 464 aa
MILLVVLMLSAEIGSGALMSTEDPKPPSVPAPTNVLITSYDLNPVVHWKHQNVSQAAVFT
VQVKMYPDNWTDACTNIAHHYCNIYKHISYPDSSAWARVKAKVGQRESAYAQSEEFIMCR
KGKVGPPGLDIGRKEDQLIVHIFHPKVNVSQETMFGDGNTCYTFDYTVFVKHYRSGEILH
TEHSVLKEDCSETLCELNISVSTLNSNYCVSVVGKSSFWQVNTETSKDACIPFLHDDREE
SIWMLLVAPLLFLTIVVPALVCCYIKKNPFKRKSIMLPKSLLSVVKNATSETKPESKYSL
VTSCQPAVLENETVICEEHLSTVTTPDSLEAPEQEELSKGTVATVAEGNTSPETTDSPPT
PVQSGHFSLSSSNQSGSCSLTTYHSRDGSDSGLVGTGSSISDSDFLPNNDSETKMADPAP
TPVRKALTFSGYDKPHVLVDVPVDGEGKESLIGYRLTGDTQELS
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgattctgctggtggtcctgatgctgtctgcggagatcgggagtggagctttgatgagc
accgaggatcctaagccgccctcggtgcctgcgccaacaaatgttctaattacgtcctat
gacttgaaccctgtcgtacattggaagcaccagaacgtgtcgcaggctgccgtcttcact
gtacaggtaaagatgtatccggataactggactgatgcctgcaccaacattgcccatcat
tattgtaatatctacaaacacatttcctatcctgactcatctgcctgggccagagttaag
gccaaggttggacaaagagaatctgcctatgcacagtcagaagagtttattatgtgccga
aaggggaaggttggaccgcctggcctggacatcggaaggaaggaagatcagctgattgtc
cacatatttcaccctaaggtcaatgtgagtcaggaaaccatgtttggtgacggaaatacc
tgttacacattcgactacactgtgtttgtgaaacattacaggagtggggagatcctacat
acagaacatagcgtcctaaaagaagattgtagcgaaactctgtgtgagttaaacatctca
gtgtccacgctgaattccaattactgtgtttcagtagttggaaagtcgtctttctggcaa
gttaatacagaaacatcaaaagacgcctgtatcccctttctccatgatgacagagaagaa
tcaatttggatgctgcttgttgctcctcttctcttccttacaatagttgtcccggcactt
gtgtgttgttacattaagaagaatccatttaagagaaaaagcataatgttacctaagtcc
ttgctctctgtggtaaaaaatgccacgtccgagaccaaacctgaatcaaagtactccctt
gtcacgtcgtgccagccagctgtcctagagaacgagacagtgatctgtgaggagcacttg
tccacagtgacaactccagacagcctagaagcaccagagcaggaagaactttctaaagga
accgtggctacggttgctgaaggaaacacttcccccgagaccaccgacagccctccaact
ccggtacaaagtggccatttttccctgtcaagtagtaaccagtcaggctcctgtagcctc
accacctatcactccagggacggctctgacagtggcctcgtgggcacaggcagctccata
tctgactctgactttctcccaaacaacgactcggaaacaaagatggcagacccagcccct
acacctgtgaggaaggccctgactttctccggttatgacaaaccacacgtgttggtggac
gtgcccgtggatggggagggcaaggagtctttgattgggtatagactcacgggtgatacc
caggaactgtcctaa

KEGG   Rattus norvegicus (rat): 360697
Entry
360697            CDS       T01003                                 

Gene name
Ifngr2
Definition
(RefSeq) interferon gamma receptor 2 precursor
  KO
K05133  interferon gamma receptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04066  HIF-1 signaling pathway
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05200  Pathways in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    360697 (Ifngr2)
   04066 HIF-1 signaling pathway
    360697 (Ifngr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    360697 (Ifngr2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    360697 (Ifngr2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    360697 (Ifngr2)
   04658 Th1 and Th2 cell differentiation
    360697 (Ifngr2)
   04659 Th17 cell differentiation
    360697 (Ifngr2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    360697 (Ifngr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    360697 (Ifngr2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    360697 (Ifngr2)
  09172 Infectious disease: viral
   05164 Influenza A
    360697 (Ifngr2)
   05168 Herpes simplex virus 1 infection
    360697 (Ifngr2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    360697 (Ifngr2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    360697 (Ifngr2)
   05140 Leishmaniasis
    360697 (Ifngr2)
   05142 Chagas disease
    360697 (Ifngr2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    360697 (Ifngr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    360697 (Ifngr2)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IFN receptor family
   360697 (Ifngr2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind DUF6520
Other DBs
NCBI-GeneID: 360697
NCBI-ProteinID: NP_001101783
RGD: 1307532
Ensembl: ENSRNOG00000002032
UniProt: D4A109
Position
11
AA seq 330 aa
MRPPPLWLPLLLLCGLGAAVSSPDSLSQLAAPRKLKLHLYNDEQMLSWEPSPSSNDTRPV
VYQVEYSYVDGSWHRLREPNCTDIAETKCDFTGGGRLKVFPYSYTVFLRVRARLGKHTSH
WVKLDPFQHYENVTVGPPKNISVTPGKGSLVIHFSPPFDVVQEASFQYFVHYWEKTETQK
VKGPYKSNSIVLDDLKPFRVYCLQTKAQLILKNRNIGPHGLLSNVSCHETTADASTSLQQ
VILILFGIFMLLLALTGACFILFLRYQSRVKYWFQAPPDIPEQIKEYLKDPDQLILEALD
KDGSPKDEAWDSVSIISSPEKEQDDVLQIP
NT seq 993 nt   +upstreamnt  +downstreamnt
atgcggcctccgccactgtggctgccgttgctgttgctctgtgggctcggcgccgcggtg
tcttctccagactccttgtcccagcttgctgcccctaggaagctgaagcttcacctgtac
aatgacgagcagatgctaagctgggagccttcgccctccagcaacgacacgagaccagtg
gtctaccaggtggagtacagctacgtcgatggctcttggcataggctgcgggagccgaac
tgtacggacatcgcagagacgaaatgtgacttcacaggaggcggccgcttgaaggttttc
ccatactcatacacagtcttcctgcgcgtgcgagccaggctcggaaagcacacttcccac
tgggtgaagctggatccatttcaacactatgagaatgttactgttggacctccaaaaaac
atctcggtgaccccagggaaaggctccctcgtcatacacttctcccctccctttgacgtg
gtccaggaggcatcttttcagtattttgtccactactgggaaaagacagaaacccaaaag
gttaaaggcccttacaagagcaactccattgtgctggatgatttgaagccattcagagta
tattgtttacaaaccaaggcccaactgattttgaaaaacagaaatatcggaccgcacggg
ctcctgagcaatgtatcttgtcacgaaacaacagcggatgcctccaccagcctgcagcaa
gtcatcctgatcctttttggcatcttcatgttgctgctggcactgacgggagcctgcttc
atcctgttcctcagataccaaagccgggtgaaatactggtttcaagctccaccagacatc
ccagaacaaataaaagagtatttaaaggacccagatcagctcatcctggaggccttggac
aaggacggttcgccgaaggatgaggcctgggactccgtatcaatcatttcgtctccagaa
aaggagcaggatgatgtgctccaaataccctga

DBGET integrated database retrieval system