KEGG   Rattus norvegicus (rat): 116469Help
Entry
116469            CDS       T01003                                 

Gene name
Trpv5, CaT2, Ecac1
Definition
(RefSeq) transient receptor potential cation channel, subfamily V, member 5
  KO
K04974  transient receptor potential cation channel subfamily V member 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04961  Endocrine and other factor-regulated calcium reabsorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    116469 (Trpv5)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    116469 (Trpv5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    116469 (Trpv5)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   116469 (Trpv5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ion_trans Ank_3 Ank_5 Ank Ank_4
Motif
Other DBs
NCBI-GeneID: 116469
NCBI-ProteinID: NP_446239
RGD: 620636
Ensembl: ENSRNOG00000015394
UniProt: Q9JIP0
Position
4q23
AA seq 723 aa AA seqDB search
MGVKKPWIQLQKRLNWWVREQDWNQHVDQLHMLQQKSIWESPLLRAAKENDMCTLKRLQH
DQNCDFRQRGALGETALHVAALYDNLDAAIMLMETAPYLVTESTLCEPFVGQTALHIAIM
NQNVNLVRALLARGASASARATGSAFHRSSHNLIYYGEHPLSFAACVGSEEIVRLLIEHG
ADIRAQDSLGNTVLHILVLQPNKTFACQMYNLLLSHDGGDHLKSLELVPNNQGLTPFKLA
GVEGNTVMFQHLMQKRKHIQWSLGPLTSSIYDLTEIDSWGEDLSFLELVLSSKKIEARQI
LEQTPVKELVSLKWKKYGQPYFCLLGMLYISYMICFTTCCVYRPLKFRDANRTHVRDNTV
LEQKPLQEAYVTYQDKVRLVGELVTVIGAVVILLIEIPDIFRVGASRYFGHTVLGGPFHV
IIITYASLVLLIMVMRLTSMNGEVVPISMALVLGWCSVMYFSRGFQMLGPFTIMIQKMIF
GDLLRFCRLMAMVILGFASAFYIIFQTEDPESLGEFSDYPTAMFSTFELFLTIIDGPANY
SVDLPFMYHLTYFAFAIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVVATTVMLERK
MPRFLWPRSGICGCEYGLGDRWFLRVEHHQEQNPYRVLRYVEAFKSSDKEEVQEQLSEKQ
PSGTETGTLARGSVVLQTPPLSRTTSLSSNSHRGWEILRRNTLGHLNLGQDLGEGDGEEI
YHF
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgaaaaaaccttggatccaacttcagaaacgtctcaactggtgggtcagagaa
caagactggaaccagcatgtggatcagcttcatatgctacagcagaaaagtatttgggag
tcaccactgcttagagcagccaaggaaaatgatatgtgcacacttaagagacttcaacat
gaccagaactgtgacttccgacaaagaggagctctgggggagacagcactgcatgtagca
gccctctatgacaacctggatgctgctataatgctgatggagactgctccatacttggtc
acggagtctacactgtgtgagccatttgtaggtcagactgcactgcacatcgcaattatg
aaccagaatgtgaacctggtccgtgccctgctagcccgaggagccagtgcctccgccagg
gctacaggttctgccttccatcgaagttcccacaacctcatctactatggagaacatcct
ttgtcctttgctgcctgtgtgggtagtgaggagattgttagactgctcattgagcatgga
gctgacattcgggcccaggactccttgggaaatacagtactacacatacttgtcctacag
cccaacaaaacctttgcctgccagatgtacaacctgctactctcccatgatgggggagac
cacctgaagtccctggaacttgtgcccaacaaccaaggactcacccccttcaagctggct
ggggtggaaggcaacactgtgatgtttcaacacctgatgcaaaaacggaagcacatccag
tggtcattaggacccctaacatcttccatttatgatctcacagaaattgactcctggggt
gaggacttgtcctttctggagcttgtgctttcctccaagaagatagaggctcgtcagatt
ctagaacaaacccctgtgaaggagctggtgagcctgaagtggaagaaatatggacaaccc
tatttctgcctcctgggtatgctgtacatctcctacatgatctgcttcaccacatgctgt
gtttaccgccccctcaagttccgtgatgccaaccgtacacatgttagagataacaccgtc
ctggaacagaaaccactacaggaagcgtatgtgacttaccaggataaggtccggctggtg
ggagaactcgtgacagtcattggggctgtggttattctactcatagagatcccagacatc
ttcagagttggtgcctctcgctactttggacacacagttcttgggggtccattccatgtc
attatcatcacatatgcctcccttgtgctactgattatggtgatgaggcttaccagtatg
aatggggaggtggtccccatatccatggccttggtactgggctggtgtagtgtcatgtac
ttctcccgaggattccagatgctgggccccttcacaatcatgattcagaagatgattttt
ggagacctactgcgcttctgccggctaatggctatggtcatcctcggatttgcctctgcc
ttctatatcatcttccagaccgaggatccagagagtctgggagaattctccgactaccct
acagcaatgttcagcacctttgagctcttccttaccatcattgacggtccggccaattac
agtgtggatctacccttcatgtaccacctaacctattttgcttttgccatcatcgccaca
ctactcatgctcaatttgttcattgccatgatgggtgacactcactggcgagtggcccag
gagagggacgaactctggagagcacaggttgtagccaccacagtgatgctggagaggaaa
atgccccgtttcctgtggcctcgctctggtatctgtggttgcgaatatggcctgggagac
cgctggttcttacgggttgaacaccaccaggagcagaatccgtatcgagtacttcgctat
gtggaagctttcaaatcttcagacaaggaggaagtacaagaacaactatctgagaagcag
ccttccgggactgagactgggactttagctagaggctctgtggttctgcaaacgcctcct
ttgtccaggactacatccctaagcagcaatagccaccgtggatgggaaattctccgtcga
aacaccctgggacatttgaatcttggacaagaccttggtgagggagacggagaggagatc
taccatttctga

DBGET integrated database retrieval system