KEGG   Rattus norvegicus (rat): 116470
Entry
116470            CDS       T01003                                 

Gene name
Stx1a
Definition
(RefSeq) syntaxin-1A
  KO
K04560  syntaxin 1A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04130  SNARE interactions in vesicular transport
rno04721  Synaptic vesicle cycle
rno04911  Insulin secretion
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05031  Amphetamine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    116470 (Stx1a)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    116470 (Stx1a)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    116470 (Stx1a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    116470 (Stx1a)
   05022 Pathways of neurodegeneration - multiple diseases
    116470 (Stx1a)
  09165 Substance dependence
   05031 Amphetamine addiction
    116470 (Stx1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    116470 (Stx1a)
Membrane trafficking [BR:rno04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    116470 (Stx1a)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 Ferritin GNVR PspA_IM30 Prominin Syntaxin-6_N Laminin_II FAD_binding_1 DUF1910 SIMPL Lzipper-MIP1 FlgN DUF148 YtxH CHDCT2 Lipoprotein_2
Other DBs
NCBI-GeneID: 116470
NCBI-ProteinID: NP_446240
RGD: 69430
Ensembl: ENSRNOG00000029165
UniProt: P32851 A0A1E1ERK2
Structure
PDB: 

Position
12
AA seq 288 aa
MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSA
ILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQH
STLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASG
IIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHA
VDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaaggaccgaacccaggagctccgcacggccaaggacagcgatgacgacgatgatgtc
actgtcactgtggaccgagaccgcttcatggatgagttctttgaacaggtggaagagatc
cggggctttattgacaagattgctgaaaacgtggaggaggtgaagaggaaacacagcgcc
atcctggcctccccgaaccccgatgagaagaccaaggaggaactggaggagctcatgtcg
gacattaagaagacagcgaacaaagttcgctccaagctaaagagcatcgagcagagcatc
gagcaggaggaaggtctgaaccgctcgtcggcggacctgaggatccggaagacgcagcat
tccacgctgtcccgaaagtttgtggaggtcatgtccgagtacaacgccactcagtcagac
taccgagaacgctgcaaagggcgcatccagaggcagctggagatcactggccggaccacg
accagtgaggagttggaagacatgctggagagtgggaatcccgccatctttgcctctggg
atcatcatggactccagcatctcgaagcaggccctcagtgagatcgagaccaggcacagt
gagatcatcaagttggagaacagcatccgggagctacacgatatgttcatggacatggcc
atgctggtggagagccagggggagatgattgacaggatcgagtacaatgtggaacacgct
gtggactacgtggagagggccgtgtctgacaccaagaaggccgtcaagtaccagagcaag
gcacgcaggaagaagatcatgatcatcatttgctgtgtgattctgggcatcatcatcgcc
tccaccatcgggggcatctttggatag

DBGET integrated database retrieval system