KEGG   Rattus norvegicus (rat): 116472
Entry
116472            CDS       T01003                                 

Gene name
Il17b
Definition
(RefSeq) interleukin-17B precursor
  KO
K05490  interleukin 17B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    116472 (Il17b)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    116472 (Il17b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    116472 (Il17b)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   116472 (Il17b)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 116472
NCBI-ProteinID: NP_446241
RGD: 620614
Ensembl: ENSRNOG00000019695
UniProt: G3V8K9
Position
18
AA seq 180 aa
MDWPHSLLFLLAISIFLVPSQPRNTKGKRKGQGRPGPLAPGPHQVPLDLVSRVKPYARME
EYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPEDLPEAR
CLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF
NT seq 543 nt   +upstreamnt  +downstreamnt
atggactggccacacagcctgctcttccttcttgccatctccatcttcctggtgccaagc
cagccccggaacaccaaaggcaaaaggaaggggcaagggaggcctggccccttggcccct
gggcctcaccaggtgccgctggacctggtgtctcgagtaaagccctacgcccgaatggaa
gagtacgagaggaaccttggcgagatggtggcccagctgaggaacagctctgagccagcc
aagaagaagtgtgaagtcaacttgcagctgtggttatccaacaagagaagcctgtctccc
tggggctacagcatcaatcacgaccccagccgcatcccggaggacttgcctgaggcgcgg
tgcctatgtttgggttgcgtgaaccccttcaccatgcaggaggaccgtagcatggtgagc
gtgccagtgttcagccaggtgccagtgcgccgccgcctctgtccgcaacctcctcggccc
gggccctgccgccagcgtgttgtcatggagaccatcgctgtgggttgcacctgcatcttc
tga

DBGET integrated database retrieval system