KEGG   Rattus norvegicus (rat): 116484
Entry
116484            CDS       T01003                                 

Gene name
Txn1
Definition
(RefSeq) thioredoxin
  KO
K03671  thioredoxin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno05012  Parkinson disease
rno05132  Salmonella infection
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    116484 (Txn1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    116484 (Txn1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    116484 (Txn1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    116484 (Txn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    116484 (Txn1)
Chaperones and folding catalysts [BR:rno03110]
 Protein folding catalysts
  Protein disulfide isomerase
   116484 (Txn1)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_8 Thioredoxin_7 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Glutaredoxin Thioredoxin_9
Other DBs
NCBI-GeneID: 116484
NCBI-ProteinID: NP_446252
RGD: 621157
Ensembl: ENSRNOG00000012081
UniProt: P11232
Position
5
AA seq 105 aa
MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSNVVFLEVDVD
DCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEATITEFA
NT seq 318 nt   +upstreamnt  +downstreamnt
atggtgaagctgatcgagagcaaggaagcttttcaggaggccctggccgctgcgggagac
aagcttgtggtagtggacttctctgccacgtggtgtggaccttgcaaaatgatcaagccc
ttctttcattccctctgtgacaagtattccaatgtggtgttccttgaagtagacgtggat
gactgccaggatgttgctgcagactgtgaagtcaaatgcatgccgaccttccagttctat
aaaaagggtcaaaaggttggggagttctctggtgctaacaaggaaaagctcgaagccact
attacggagtttgcctaa

KEGG   Rattus norvegicus (rat): 79462
Entry
79462             CDS       T01003                                 

Gene name
Txn2
Definition
(RefSeq) thioredoxin, mitochondrial precursor
  KO
K03671  thioredoxin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno05012  Parkinson disease
rno05132  Salmonella infection
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    79462 (Txn2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    79462 (Txn2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    79462 (Txn2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    79462 (Txn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    79462 (Txn2)
Chaperones and folding catalysts [BR:rno03110]
 Protein folding catalysts
  Protein disulfide isomerase
   79462 (Txn2)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_7 Thioredoxin_3 Thioredoxin_8 DSBA Thioredoxin_9 HyaE AhpC-TSA Glrx-like
Other DBs
NCBI-GeneID: 79462
NCBI-ProteinID: NP_445783
RGD: 71040
Ensembl: ENSRNOG00000005614
UniProt: P97615
Position
7
AA seq 166 aa
MAQRLLLRRFLTSVISRKPPQGVWASLTSTSLQTPPYNAGGLTGTPSPARTFHTTRVCST
TFNVQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDD
HTDLAIEYEVSAVPTVLAIKNGDVVDKFVGIKDEDQLEAFLKKLIG
NT seq 501 nt   +upstreamnt  +downstreamnt
atggctcagcggcttctcctgaggaggttcctgacctcagtcatctccaggaagcctcct
caaggtgtgtgggcttccctcacctctacgagcctgcagacccctccgtacaatgctggt
ggtctaactggaacacccagccctgcccggacatttcacaccaccagagtctgttcaaca
acctttaacgtccaggatggacctgactttcaagacagagttgtcaacagtgagacacca
gttgtcgtggactttcatgcacagtggtgtggcccctgcaagatcctaggacctcggtta
gagaagatggtagccaaacagcacgggaaggtggtgatggccaaagtggacattgacgat
cacacagaccttgccattgagtacgaggtgtctgctgtgcctaccgtgctggccatcaag
aacggggacgtggtggacaagtttgtggggatcaaggacgaagaccagctggaagccttc
ctgaagaagctaattggctga

DBGET integrated database retrieval system