KEGG   Rattus norvegicus (rat): 116486
Entry
116486            CDS       T01003                                 

Gene name
Sec14l2, Spf
Definition
(RefSeq) SEC14-like lipid binding 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: CRAL_TRIO CRAL_TRIO_2 GOLD_2 CRAL_TRIO_N
Other DBs
NCBI-GeneID: 116486
NCBI-ProteinID: NP_446253
RGD: 621779
Ensembl: ENSRNOG00000004672
UniProt: Q5EBD0
Position
14q21
AA seq 403 aa
MSGRVGDLSPKQEEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHV
EFRKQKDIDKIISWQPPEVIQQYLSGGRCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDL
LRTKMRDCELLLQECTHQTAKLGKKIETITMIYDCEGLGLKHLWKPAVEAYGEFLTMFEE
NYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQLPVE
YGGTMTDPDGNPKCKSKINYGGDIPKQYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPG
CVLRWQFMSEGSDVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHMVPEDGTLTCSEPGI
YVLRFDNTYSFIHAKKVSFTVEVLLPDKAAEEKLNQQGTVTPK
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgagcgggagagtcggtgacctgagccccaaacaggaggaggcactggccaagtttcga
gaaaatgtccaggacgtgctgcctgccctgcccaatccagatgactactttctccttcga
tggctccgagcccgaagctttgacctgcagaagtcggaggccatgctccggaagcatgtg
gaattccggaagcaaaaggacattgacaaaatcatcagctggcagccaccagaggtgatc
caacagtatctgtcaggcggccggtgtgggtatgacctggacggctgccctgtctggtat
gacatcatcggcccactggatgccaagggtctgctgttctccgcctccaagcaagacctg
ctcaggaccaagatgagagattgtgagctgcttctgcaggagtgcacccatcagaccgca
aagctagggaagaagatagagaccatcaccatgatttacgactgtgagggactcggcctc
aagcacctctggaaacctgcagtggaggcctatggagagtttctcaccatgtttgaggag
aactatcctgaaacgctgaagcggctgttcgtcgttaaagcccccaagctgtttccagtg
gcctacaacctcatcaagcccttcctgagtgaggacactaggaagaagatcatggttctg
ggagcaaactggaaggaggttttactcaaacacatcagccccgaccagttgcctgtggag
tatggaggcaccatgacggaccctgatggaaaccccaagtgtaaatccaagatcaactat
gggggtgacatccccaagcagtattacgtgcgagaccaggtgaagcagcagtatgaacac
agtgtgcagatctcccgaggctcctcccaccaagtagagtatgagattcttttccccggc
tgcgtcctcaggtggcagtttatgtcggagggatcagacgtgggttttgggattttcctg
aagaccaagatgggggaacggcagcgggcaggggagatgacggaggtgctgcctaaccag
agatacaattcccacatggtccctgaggatgggaccctcacctgcagtgagccaggcatc
tatgtcctacggtttgacaacacctacagcttcatccatgccaagaaagtcagtttcact
gtggaggtcctgcttccagacaaagcagcagaagagaagttgaatcagcaggggacagtc
acccccaaataa

DBGET integrated database retrieval system