KEGG   Rattus norvegicus (rat): 116487Help
Entry
116487            CDS       T01003                                 

Gene name
Tgfbi, BIGH3, Big-h3
Definition
(RefSeq) transforming growth factor, beta induced
  KO
K19519  transforming growth factor-beta-induced protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    116487 (Tgfbi)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fasciclin
Motif
Other DBs
NCBI-GeneID: 116487
NCBI-ProteinID: NP_446254
RGD: 620017
Ensembl: ENSRNOG00000012216
UniProt: D4A8G5
Position
17p14
AA seq 685 aa AA seqDB search
MALLVRLLPLALALSLGFTGTLAGPAKSPYQLVLQHSRLRGRQHGPNVCAVQKVIGTNKK
YFTNCKQWYQRKICGKSTVISYECCPGYEKVPGEKGCPAALPLSNLYETLGIVGSTTTQL
YTDRTEKLRPEMEGPGSFTIFAPSNEAWSSLPAEVLDSLVSNVNIELLNALRYHMVDRRV
LTDELKHGMALTSMYQNSNIQIHHYPNGIVTVNCARLLKADHHATNGVVHLIDKVISTVT
NNIQQIIEIEDTFETLRAAVAASGLNTVLEGDGQFTLLAPTNEAFEKIPAETLNRILGDP
EALRDLLNNHILKTAMCAEAIVAGMAMETLGGTTLEVGCSGDMLTINGKAVISNKDILAT
NGVIHFIDELLIPDSAKTLLELASESDVSTAIDLLRQAGLSTHLSGKEQLTFLAPLNSVF
KDGVPRIDGQMKTLLLNHMVKGQLASKYLYSGQTLDTLGGKKLRVFVYRNSLCIENSCIA
AHDKKGRYGTLFTMDRMLTPPMGTVMDVLKGDNRFSMLVAAIQSAGLMETLNREGVYTVF
APTNEAFQAMPPEELNKLLANAKELTNILKYHIGDEILVSGGIGALVRLKSLQGDKLEVS
SKNNVVSVNKEPVAETDIMATNGVVYAINTVLQPPANRPQERGEELADSALEIFKKASAY
SRSAQSSMRLAPVYQRLLERMKRRG
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcctcgtgcggctgctgcccctcgctctggctctgtctctgggcttcaccggg
accctggcgggcccggccaagtcaccctatcagctggtgctgcagcacagccggctccgg
ggccgccagcacggccccaatgtatgtgctgtgcagaaggtcattggcactaacaagaaa
tacttcaccaactgcaagcagtggtaccagaggaagatctgcggcaagtcgacagtcatc
agctatgagtgctgccccggatatgaaaaggtcccaggagagaaaggctgccctgcagct
cttccgctctccaatctgtacgagaccttgggaattgtgggatcgaccaccacacagctg
tacacagatcgcacagaaaagctgaggcctgagatggagggacccggcagcttcaccatc
tttgcccctagcaacgaggcctggtcctccttgcctgcggaagtgctggactccctggtg
agcaatgtcaacattgaactgctcaacgccctccgctaccacatggtggacagacgggtc
ctgacagacgagcttaagcacggcatggctctcacctccatgtaccagaactccaacatc
cagatccatcactatcccaatgggattgtaactgttaactgtgcccggctgctgaaagct
gaccaccatgcgaccaacggcgtggtgcatctcattgataaggtcatttccaccgttacc
aacaacatccagcagatcatcgagattgaggacacctttgagacacttcgggccgccgtg
gctgcatcaggactcaataccgtgctggagggtgacggccagttcacactcttggcccca
accaacgaggcctttgagaagattcctgctgagaccttgaaccggatcctgggtgacccc
gaggccctgagagacctgctaaacaatcatatcctgaagacagccatgtgtgctgaggcc
attgtggctggaatggccatggagaccctggggggcaccacactggaggtgggctgcagt
ggagacatgctcactattaacgggaaggctgtcatctccaacaaagacatcctggccacc
aacggtgtcatccacttcattgatgagctgctcatcccagattcagccaagacattgctc
gagctcgcttcggaatctgacgtctccacagccattgacctcctcagacaagctggcctc
agcacgcatctctctggaaaagaacagttgaccttcctggcccctctgaattctgtgttc
aaagatggtgtcccccgcattgacggccaaatgaagactttgcttctgaaccacatggtc
aaagggcagttggcctccaaatatttgtactccggacagacactggacacactgggtggc
aaaaagcttcgagtttttgtttatcgaaatagcctctgcattgaaaacagctgcattgcc
gcccatgacaagaagggacggtatgggaccctgttcaccatggaccggatgctgacaccc
cctatggggactgttatggatgtcctgaagggggacaaccgttttagcatgctggtggcc
gccatccagtctgcaggcctgatggagaccctcaaccgggaaggggtctacactgttttc
gctcccacgaacgaagcgttccaagccatgcctccagaagagctgaacaaactcttggca
aatgccaaggaacttaccaacatcctgaagtaccacattggggatgagatcctggttagc
ggaggcattggggctctggtgcggctgaagtctctccaaggggacaaactggaagtcagc
tcgaaaaacaatgtggtgagtgtcaataaggaacctgttgccgaaaccgacatcatggcc
acaaacggtgtggtgtatgccatcaacactgttctgcaaccgccagccaaccggccacaa
gaacggggagaagagttggcagactctgcccttgaaatcttcaagaaggcgtcagcctat
tccaggagtgcccagagttctatgcgacttgcccctgtctatcagcggttactagagagg
atgaagcggagaggatga

DBGET integrated database retrieval system