KEGG   Rattus norvegicus (rat): 116498
Entry
116498            CDS       T01003                                 

Gene name
F2rl3
Definition
(RefSeq) proteinase-activated receptor 4
  KO
K04236  coagulation factor II (thrombin) receptor-like 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04610  Complement and coagulation cascades
rno04611  Platelet activation
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    116498 (F2rl3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    116498 (F2rl3)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    116498 (F2rl3)
   04611 Platelet activation
    116498 (F2rl3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116498 (F2rl3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    116498 (F2rl3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Thrombin
    116498 (F2rl3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srw 7TM_GPCR_Srx 7TM_GPCR_Srv 7TM_GPCR_Str
Other DBs
NCBI-GeneID: 116498
NCBI-ProteinID: NP_446260
RGD: 620872
Ensembl: ENSRNOG00000048186
UniProt: Q920E0
Position
16
AA seq 386 aa
MLGFSISPAECQTPSIYDDVESTREGQEASLRPTVELNESKSPDKPNPRGFPGKPCANNS
DTLELPASSEALLLGWVPTRLVPAIYGLVVVVGLPANGLALWVLATRVPRLPSTILLMNL
AVADLLLALVLPPRLVYHLRGQRWPFGEAACRVATAALYGHMYGSVLLLAAVSLDRYLAL
VHPLRARALRGQRLTTILCLVAWLSAATLVLPLTFHRQTFLLAGSDRMLCHDALPLAEQT
SHWRPAFICLAVLGCFVPLLAMVLCYGATLRALAANGQRYSHAVRLTALVLFSAVAAFTP
SNVLLVLHYSNPSPEAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSHEFREKVRAMLCRQ
LKASSSSQASREAGSRGTAICSSTLL
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgctcgggttcagcatcagcccggcggaatgccagacgcccagcatctacgacgatgta
gagagtaccagggaaggccaagaagcctctctgcgtcccacagtagaacttaatgagtcg
aagtccccagacaagcctaatccacgaggcttcccgggcaagccctgtgccaacaacagt
gacacgctggagctcccagccagctctgaagcactgcttctggggtgggtccccacgagg
ctggtacctgccatctatgggctagtggtggtcgtggggctgcctgccaatgggctagcg
ctgtgggtgctggccacaagggtcccacgcttgccatccaccattctgctcatgaacctg
gcagtggctgacttgctactggccctggtgctcccaccacgactggtttatcacctgcgt
ggccagcgctggccgtttggggaggctgcctgccgggtggccacagctgccctctatggc
cacatgtatggttcagtgttgcttctggccgcagtcagcctggacagatacctggccctg
gtgcatcctttgcgggcccgggcattgcgtggtcaacgcctcaccaccatactctgcttg
gtggcctggctctctgcagccactctagtcttgccactcacgtttcatcggcagaccttc
ctattggctggctccgatcgcatgctgtgtcatgatgcgctgccattggcggagcagacc
tcccattggagaccggccttcatctgcctggctgtcctgggctgctttgtgccactgctg
gccatggtcctgtgctatggggccacccttcgtgcactggcagccaatggtcagcggtac
agccatgcagtgagactgacagccctggtcctgttctcagcagtggccgctttcacacct
agcaatgtgcttctggtgctgcactattcaaacccaagccctgaggcctggggcaatctc
tatggagcctatgttcccagcctggcactcagcacccttaacagctgcgtagaccctttc
atctactactatgtgtcccacgagttcagggagaaggtacgggctatgttgtgtcgccag
ctgaaggccagcagctcctctcaggcctccagggaggctggaagccgagggactgccatt
tgctcctctacacttctgtga

KEGG   Rattus norvegicus (rat): 116744
Entry
116744            CDS       T01003                                 

Gene name
Lpar1
Definition
(RefSeq) lysophosphatidic acid receptor 1
  KO
K04289  lysophosphatidic acid receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04540  Gap junction
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    116744 (Lpar1)
   04072 Phospholipase D signaling pathway
    116744 (Lpar1)
   04151 PI3K-Akt signaling pathway
    116744 (Lpar1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    116744 (Lpar1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    116744 (Lpar1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    116744 (Lpar1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116744 (Lpar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    116744 (Lpar1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    116744 (Lpar1)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 116744
NCBI-ProteinID: NP_446388
RGD: 620563
Ensembl: ENSRNOG00000013656
UniProt: P61794
Position
5
AA seq 364 aa
MAAASTSSPVISQPQFTAMNEQQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVC
VFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIDHCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRNENPNGPTEGSDRSASSLNHTILAGVHSND
HSVV
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggcagctgcctctacttccagccctgtgatttcacagccccagttcacagccatgaac
gaacaacagtgcttctacaacgagtctatcgccttcttctataaccggagtggaaagtat
ctagccacagaatggaacactgtgagcaagctggtgatgggactgggcatcactgtctgc
gtgttcatcatgctggccaatctactggtcatggtggcaatttacgtcaaccgccgcttc
catttccctatttattacttgatggccaacctggctgctgcagacttcttcgctggactg
gcctacttctacctgatgttcaacacgggacctaatacccggagactgaccgtgagcaca
tggcttctccggcagggcctcatcgacaccagcctgacggcttctgtggccaacctgctg
gccattgccatcgagaggcacatcacagttttccgaatgcagctccatacacgaatgagc
aaccgacgtgtggtggtggtgattgtagtcatctggactatggccattgtgatgggtgcc
atacccagtgtgggctggaactgcatctgtgatatcgatcattgttccaacatggcgccc
ctctacagtgactcctacttagtcttctgggccattttcaacctggtgacctttgtggtc
atggtggttctctacgctcacatctttggctatgttcgccagaggactatgagaatgtcc
cggcatagttctggacccaggaggaatcgggacaccatgatgagccttctgaagactgtg
gtcattgtgctgggtgcctttattgtctgctggactccgggattggtcttgctactgctc
gatgtgtgttgcccgcagtgcgatgtcctggcctatgagaagttcttcctcctcctggcc
gagttcaactcggctatgaaccccatcatctactcctaccgcgacaaagagatgagcgcc
accttcaggcagatcctgtgttgccagcgcaacgagaaccccaacggccccacggaaggc
tctgaccgctcggcctcctccctcaaccacactattctggctggagttcacagcaatgac
cactctgtggtttag

KEGG   Rattus norvegicus (rat): 25265
Entry
25265             CDS       T01003                                 

Gene name
P2ry1
Definition
(RefSeq) P2Y purinoceptor 1
  KO
K04270  P2Y purinoceptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04611  Platelet activation
rno04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    25265 (P2ry1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25265 (P2ry1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    25265 (P2ry1)
  09157 Sensory system
   04742 Taste transduction
    25265 (P2ry1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25265 (P2ry1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    25265 (P2ry1)
SSDB
Motif
Pfam: 7tm_1 DUF996 DUF4014
Other DBs
NCBI-GeneID: 25265
NCBI-ProteinID: NP_036932
RGD: 3242
Ensembl: ENSRNOG00000014232
UniProt: P49651
Position
2
AA seq 373 aa
MTEVPWSAVPNGTDAAFLAGLGSLWGNSTIASTAAVSSSFRCALIKTGFQFYYLPAVYIL
VFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG
DVMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAIYVSVLVWLIVV
VAISPILFYSGTGIRKNKTVTCYDSTSDEYLRSYFIYSMCTTVAMFCIPLVLILGCYGLI
VRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPEMCDFND
RVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEEMTLN
ILSEFKQNGDTSL
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgaccgaggtgccttggtcggctgtccccaacgggacagatgctgccttcctggctggc
ctgggctccctttggggaaacagtacaatcgcctcgactgcagcagtttcctcttcattc
cgatgtgccctgatcaagaccggcttccagttctactacctgcctgcggtctacatctta
gtgttcatcataggcttccttggcaacagcgtggcaatctggatgtttgttttccacatg
aagccttggagcggcatctcggtgtacatgttcaatttggctctggccgactttttgtat
gtgctcaccctaccagctctcatcttctactacttcaacaagactgactggatcttcggg
gatgttatgtgcaagctgcagaggttcatcttccatgtaaacctctatggcagcatcttg
ttcctcacctgcatcagtgcacacaggtacagtggcgtggtgtaccctctcaagtctctg
ggcaggctcaagaagaagaatgccatttatgtcagtgtgctggtatggctcattgtggtg
gtggccatctcccccattctcttctactctggcactgggattcggaaaaacaaaactgtc
acctgctacgactccacgtcagatgagtacctgcgaagttatttcatctacagtatgtgc
acgactgtggccatgttctgcatccccctggtgctgatcttgggctgttatggattaatt
gttagagctttgatctacaaagatctggacaactctcctctccggaggaaatccatttac
ctggtgataattgtcctgacggtgtttgctgtgtcttacatccctttccatgtgatgaaa
acgatgaatttgagggcacggctggatttccagaccccagaaatgtgtgatttcaacgac
agggtttatgccacctatcaggtaacaagaggtctagcaagtctcaacagctgtgtggac
cccattctttatttcttggctggagatacattcagaaggagactgtcccgagccaccagg
aaagcttccaggaggagtgaggccaatttacaatccaagagtgaagaaatgactctcaac
attttgtctgagttcaagcagaacggagacacaagtttgtga

KEGG   Rattus norvegicus (rat): 25369
Entry
25369             CDS       T01003                                 

Gene name
Adora2a
Definition
(RefSeq) adenosine receptor A2a A2AR
  KO
K04266  adenosine receptor A2a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04270  Vascular smooth muscle contraction
rno05012  Parkinson disease
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    25369 (Adora2a)
   04020 Calcium signaling pathway
    25369 (Adora2a)
   04024 cAMP signaling pathway
    25369 (Adora2a)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25369 (Adora2a)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    25369 (Adora2a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    25369 (Adora2a)
  09165 Substance dependence
   05034 Alcoholism
    25369 (Adora2a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25369 (Adora2a)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    25369 (Adora2a)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 GPR_Gpa2_C Ni_hydr_CYTB 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 25369
NCBI-ProteinID: NP_445746
RGD: 2049
Ensembl: ENSRNOG00000001302
UniProt: P30543
Position
20
AA seq 410 aa
MGSSVYITVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSLAAADIAVGVLAIPFA
ITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGVRAKG
IIAICWVLSFAIGLTPMLGWNNCSQKDGNSTKTCGEGRVTCLFEDVVPMNYMVYYNFFAF
VLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFALC
WLPLHIINCFTFFCSTCRHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKIIRT
HVLRRQEPFQAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSATHSGRRPNGYTLGL
GGGGSAQGSPRDVELPTQERQEGQEHPGLRGHLVQARVGASSWSSEFAPS
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgggctcctcggtgtacatcacggtggagctggccatcgctgtgctggccatcctgggc
aacgtgctcgtgtgctgggccgtgtggatcaacagtaacctgcagaacgtcaccaacttc
tttgtggtatcgctggcggcggctgacattgcagtgggtgtgctcgccatccccttcgct
atcaccatcagcaccggcttctgcgccgcctgccacggctgcctcttcttcgcctgtttt
gtcctggtcctcacgcagagttccatctttagcctcttggctatcgccatcgaccgctac
atcgccatccgaattccactccggtacaatggcttggtgacaggtgtgagggcgaagggc
atcattgcaatttgctgggtgctgtcgtttgccattggcctgacccccatgctgggctgg
aacaactgcagtcagaaagacgggaactccacgaagacctgcggcgagggccgggtgacc
tgtctgttcgaggacgtggtgcccatgaattacatggtttactacaacttctttgcgttc
gtgttactgccccttctgctcatgctggccatctacctacggatttttctggcggcccgg
agacagctgaagcagatggagagccagcccctgccaggggagcggactcggtccacgctg
cagaaggaggtccacgctgccaagtccctggccatcatcgtcgggctctttgctctgtgc
tggttgccgctgcacatcatcaactgtttcaccttcttctgctccacgtgccggcacgcc
cctccgtggctcatgtacctggccatcatcctctcccacagcaactccgtcgtcaacccc
ttcatctacgcctacaggatccgggagttccgccagaccttccggaagatcatccgaacc
cacgtcctgaggcggcaggaacccttccaggcagggggttccagtgcctgggccctggca
gctcacagcactgagggagagcaggttagcctccgccttaatggccaccccctgggggta
tgggccaacggcagtgccacccattccggacggcggcccaatggctacactctggggctg
gggggtggagggagtgcccaaggctctcctcgggatgtggagcttcctacccaggagcgc
caggaaggccaagagcaccctggcctaaggggtcatctggtccaggctagagtaggagct
tcctcatggtcttcagagtttgccccttcctga

KEGG   Rattus norvegicus (rat): 25439
Entry
25439             CDS       T01003                                 

Gene name
F2r
Definition
(RefSeq) proteinase-activated receptor 1 precursor
  KO
K03914  coagulation factor II (thrombin) receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04610  Complement and coagulation cascades
rno04611  Platelet activation
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    25439 (F2r)
   04020 Calcium signaling pathway
    25439 (F2r)
   04072 Phospholipase D signaling pathway
    25439 (F2r)
   04024 cAMP signaling pathway
    25439 (F2r)
   04151 PI3K-Akt signaling pathway
    25439 (F2r)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25439 (F2r)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25439 (F2r)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    25439 (F2r)
   04611 Platelet activation
    25439 (F2r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25439 (F2r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25439 (F2r)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Thrombin
    25439 (F2r)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 25439
NCBI-ProteinID: NP_037082
RGD: 2586
UniProt: Q5U324
Position
2
AA seq 432 aa
MGPRRLLLVAVGLSLCGPLLSSRVPMRQPESERMYATPYATPNPRSFFLRNPSEDTFEQF
PLGDEEEKNESIPLEGRAVYLNKSRFPPMPPPPFISEDASGYLTSPWLTLFIPSVYTFVF
IVSLPLNILAIAVFVFRMKVKKPAVVYMLHLAMADVLFVSVLPFKISYYFSGTDWQFGSG
MCRFATAAFYCNMYASIMLMTVISIDRFLAVVYPIQSLSWRTLGRANFTCVVIWVMAIMG
VVPLLLKEQTTQVPGLNITTCHDVLNETLLHGFYSYYFSAFSAIFFLVPLIISTVCYTSI
IRCLSSSAVANRSKKSRALFLSAAVFCIFIVCFGPTNVLLIVHYLLLSDSPGTETAYFAY
LLCVCVSSVSCCIDPLIYYYASSECQKHLYSILCCRESSDSNSCNSTGQLMPSKMDTCSS
HLNNSIYKKLLA
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggggccccggcgcttgctgctcgtcgcggtcggcctcagcctgtgcggtcctttgctg
tcttcccgcgttcctatgagacagccagaatctgagaggatgtatgctacgccgtatgct
acgccaaacccccgctcattttttctcaggaatcccagtgaagatacatttgaacagttc
cccctaggggatgaggaggagaaaaatgaaagcataccgctcgagggcagggcagtctac
ttaaataaaagccgttttcctcccatgccgcctcctcccttcatctccgaggacgcctcc
ggatatctgaccagcccctggctgacgctcttcataccctccgtgtacacgtttgtgttc
atagtcagccttcccctgaacatcctggccatcgctgtgtttgtctttcggatgaaggtc
aagaagccggccgtggtgtacatgctgcacctggccatggccgatgtcctcttcgtgtcc
gtgctccccttcaagatcagctactacttctccggcaccgattggcagttcgggtccgga
atgtgtcgcttcgccaccgcagcgttttattgtaacatgtacgcctccatcatgctcatg
acagtcataagcattgaccggttcctggcagtggtgtaccccatccagtccctgtcctgg
cgcactctgggccgagccaacttcacctgcgtggtcatctgggtgatggccatcatgggg
gtggtgcccctcctcctcaaagagcagaccacccaggttccggggctcaacatcaccacc
tgccacgacgtcctcaacgagaccctgctgcatggcttttactcgtactatttctccgcc
ttctccgccatcttctttcttgtgccgttgatcatttccacagtctgctacacgtccatc
atccgatgcctcagctcctccgcggtggcgaaccggagcaagaagtcgcgggctttgttc
ctgtccgccgccgtgttctgcatcttcatcgtctgctttgggcccaccaacgtcctcctg
attgtgcactacctgctcctctccgacagtcctggcacagagacggcctattttgcttac
ctcctctgcgtctgcgtgagcagcgtgagctgctgcatcgaccccttgatttactactat
gcctcctccgagtgccagaagcacctttacagcattttgtgctgcagagaaagctctgat
tccaacagttgcaacagcaccggccagctgatgcccagtaagatggatacctgctctagc
cacctgaataatagcatatacaaaaagctactagcttag

KEGG   Rattus norvegicus (rat): 292409
Entry
292409            CDS       T01003                                 

Gene name
Fpr1
Definition
(RefSeq) fMet-Leu-Phe receptor
  KO
K04172  formyl peptide receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04613  Neutrophil extracellular trap formation
rno05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    292409 (Fpr1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    292409 (Fpr1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    292409 (Fpr1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    292409 (Fpr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    292409 (Fpr1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   fMet-Leu-Phe
    292409 (Fpr1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 292409
NCBI-ProteinID: NP_001099686
RGD: 1310883
Ensembl: ENSRNOG00000011174
UniProt: D4A7Q2
Position
1
AA seq 355 aa
MNTNMSAVNFMNMSGSTRSVSAGYIVLDIFSYLIFALTFVLGVLGNGLVIWVAGFRMKRT
VTTISYLNLAIADFCFTSTLPFYIVSLVMGGIWPFGWFMCKFIYTVIDINLFGSVFLIAL
IALDRCVCVLHPVWAQNHRTVTLAKKVIIVPWICAFLLTLPVIIRVTTVPNRLGPGKTAC
ALDFSPWTKDRAEKDKVAITMYTVRGIIRFILGFSTPMSIVAICYGLIATKIHRQGLIKS
SRPLRVLSFVVAAFFLCWCPFQVVGLIRTIQIREHLRNIPQSTLTAMKITSSLAFFNSCL
NPILYVFMGQDFRQRLIHSLPASLERALSEDSAQTSDTGTNLGANSIPENPANAM
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgaacaccaacatgtctgcagtgaacttcatgaatatgtctgggagtactcgatcagta
tctgctggctacattgttctggatatcttctcatatttgatctttgcactcacctttgtg
cttggagtcttgggcaacgggctcgtgatctgggtggccggtttccgcatgaaacgcact
gtcaccaccatctcttacttgaacttggccattgctgacttttgcttcacctccactttg
ccattttacatcgtcagcctggtcatgggaggaatatggccatttggttggttcatgtgc
aagttcatatatactgtaatagacataaacctatttggaagtgtctttctgattgccctc
atagcattggatcgctgtgtttgtgtcctgcatccagtctgggctcagaaccaccgcacc
gtgaccctggccaagaaggtaatcattgtaccctggatttgtgcatttctccttactttg
ccagttatcattcgtgtgaccacagtccctaatcgacttggaccagggaaaacagcctgt
gctttagacttctcaccctggaccaaagatcgtgcagaaaaggataaagtagctatcacc
atgtatactgtcagaggaataatcaggttcatccttgggttcagcactcccatgtccatt
gtagctatttgttatgggttaatagccactaaaatccacaggcaaggtcttatcaaatcc
agccgtcccttgcgagttctctcttttgttgtggctgcctttttcctctgctggtgccca
tttcaagtagtgggcctcatacgcacaatccaaatccgtgaacacttgaggaacatacct
caaagcactctaactgctatgaaaatcacaagctctttggctttcttcaatagctgcctc
aacccaatcctttatgtcttcatgggccaggacttcagacaaagactaatccactcccta
cctgccagtctagagagggccctgagtgaggactcagctcaaaccagtgacacaggcacc
aacttgggagccaactctattcctgaaaacccagcaaatgcaatgtaa

KEGG   Rattus norvegicus (rat): 29316
Entry
29316             CDS       T01003                                 

Gene name
Adora2b
Definition
(RefSeq) adenosine receptor A2b
  KO
K04267  adenosine receptor A2b
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04270  Vascular smooth muscle contraction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    29316 (Adora2b)
   04020 Calcium signaling pathway
    29316 (Adora2b)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29316 (Adora2b)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    29316 (Adora2b)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    29316 (Adora2b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    29316 (Adora2b)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    29316 (Adora2b)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 GPR_Gpa2_C 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 29316
NCBI-ProteinID: NP_058857
RGD: 2050
Ensembl: ENSRNOG00000002922
UniProt: P29276
Position
10
AA seq 332 aa
MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFA
IPFAITISLGFCTDFHSCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGT
RARGIIAVLWVLAFGIGLTPFLGWNSKDRATSNCTEPGDGITNKSCCPVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMMVIYIKIFMVACKQLQHMELMEHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAINCITLFHPALAKDKPKWVMNVAILLSHANSVVNPVVYAYRNRDFRYS
FHRIISRYVLCQTDTKGGSGQAGGQSTFSLSL
NT seq 999 nt   +upstreamnt  +downstreamnt
atgcagctagagacgcaggacgcgctgtacgtggcgctggagctggttatcgccgcgctg
gcagtggcgggcaacgtgctggtgtgcgctgcggtgggagcctcgagtgctttacagacc
cccaccaactactttctggtgtccctggcgacggcggacgtggctgtgggactcttcgcc
atcccctttgccatcaccatcagcctgggcttctgcacggactttcacagctgcctcttc
ctcgcctgcttcgtgctggtgctcacacagagctccatctttagcctcttggcggtggct
gtcgaccggtatctggccattcgcgtcccgctcaggtataaaggtttggtcactggaaca
cgagcaagagggatcatcgctgtcctctgggtccttgcctttggcattggactgactcct
ttcctgggttggaacagtaaagaccgtgccaccagcaactgcacagaacctggggatggc
atcacgaataagagctgctgccctgtgaagtgtctctttgagaacgtagttcccatgagc
tacatggtttatttcaacttctttgggtgtgtccttcctccactgctcatcatgatggtg
atctacatcaaaatcttcatggtggcctgcaagcagcttcagcacatggaactgatggag
cactccaggaccacgctgcagcgggagatccacgcggccaagtcactggctatgattgtg
ggcatctttgctctgtgttggctccccgtgcatgccatcaactgcatcaccctcttccat
ccagccctggccaaggacaagcccaaatgggtgatgaatgtggccatcctcctgtcacac
gccaattcagttgtcaatcccgttgtctatgcctacaggaaccgggacttccgctacagt
ttccacaggatcatctccagatacgttctctgccagacggacaccaagggtgggagcggg
caggccgggggacagtcaactttcagtctgagcttgtga

KEGG   Rattus norvegicus (rat): 302378
Entry
302378            CDS       T01003                                 

Gene name
Lpar4
Definition
(RefSeq) lysophosphatidic acid receptor 4
  KO
K04275  lysophosphatidic acid receptor 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    302378 (Lpar4)
   04072 Phospholipase D signaling pathway
    302378 (Lpar4)
   04151 PI3K-Akt signaling pathway
    302378 (Lpar4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    302378 (Lpar4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    302378 (Lpar4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    302378 (Lpar4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    302378 (Lpar4)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    302378 (Lpar4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx Serpentine_r_xa 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 302378
NCBI-ProteinID: NP_001100410
RGD: 1563686
Ensembl: ENSRNOG00000002428
UniProt: D3ZHA3
Position
X
AA seq 370 aa
MGDRRFIDFQFQDLNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSAS
LFVFCFRMKMRSETAIFITNLALSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLT
NIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTN
VNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQI
GTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCLLERFAKIMYPITLCLA
TLNCCFDPFIYYFTLESFQKSFYINTHIRMESLFKTETPLTPKPSLPAIQEEVSDQTTNN
GGELMLESTF
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgggtgacagaagatttattgacttccaattccaagatttaaattcaagtctcagaccc
aggttgggaaatgcaactgccaataatacttgcattgttgacgactccttcaagtataat
ctgaatggtgctgtctatagtgttgtatttatcctgggcttaataaccaacagtgcttcc
ctgtttgtcttctgcttccgcatgaaaatgagaagtgagaccgctattttcatcaccaat
ctggccctctctgacttgctttttgtctgtaccctacctttcaaaatattttacaacttt
aaccgccactggccgtttggtgacaccctctgtaagatctcagggactgcattcctcacc
aacatctatgggagcatgctcttcctcacctgcattagtgtggatcgtttcctagccatt
gtctatcccttccgatctcgtaccatcaggaccaggaggaattccgccattgtgtgcgct
ggagtctggatcctagtcctcagtggtggtatttcagcgtctttgttttccaccactaac
gtcaacaatgcgaccaccacttgctttgaaggcttctccaaacgtgtctggaagacttac
ctgtccaagatcaccatattcattgaagttgttgggttcatcattcctctgatattgaat
gtttcctgctcttctgtggtgcttagaaccctccgcaagcctgcaacattgtctcaaatt
gggaccaataagaaaaaagtgttgaagatgatcacagtgcatatggcagtttttgtggta
tgcttcgtaccatataactctgttctctttttatatgccttggtacgttcccaagccatt
actaattgcttattggaaaggtttgcaaagataatgtacccgattaccttgtgccttgca
actctgaattgttgctttgacccttttatctattacttcactcttgaatcttttcagaaa
tccttttatatcaacacacacataaggatggagtcgctgtttaagactgagacacctctg
acccccaaaccttcccttccagctatccaagaggaagttagtgatcaaacaacaaataat
ggtggtgaactaatgctggaatccaccttctag

KEGG   Rattus norvegicus (rat): 498609
Entry
498609            CDS       T01003                                 

Gene name
Lpar2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    498609 (Lpar2)
   04072 Phospholipase D signaling pathway
    498609 (Lpar2)
   04151 PI3K-Akt signaling pathway
    498609 (Lpar2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    498609 (Lpar2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    498609 (Lpar2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    498609 (Lpar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    498609 (Lpar2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    498609 (Lpar2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srt
Other DBs
NCBI-GeneID: 498609
NCBI-ProteinID: NP_001102579
RGD: 1561336
Position
16
AA seq 265 aa
MGQCYYNETIGFFYNNSGKELSLHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRF
HQPIYYLLGNLAAADLFAGMAYLFLMFHTGPRTARLSIKGWFLRQGLLDTSLTASVATLL
AIAVERHRSVMAVQLHSRLPRGRVVTLIVGVWVAALGLGLLPAHFWHCLCDLDSCSRMVP
LFSRSYLAVWALSSLLVFLLMVAVYTRIFFFVRRRVERMAEHVSCHPRYRETTLSLVKTV
VIILGAFVVCWTPGPGGAALGRSGL
NT seq 798 nt   +upstreamnt  +downstreamnt
atgggccagtgctactacaatgagaccatcggctttttctataataacagcggcaaggag
ctcagccttcactggcgccccaaagatgtggtggtggtggccctggggctgacagtcagt
gtgctggtattgctgaccaacctgctggttattgcagccattgcctccaaccgacgcttc
caccagcccatatactacctgcttggcaacttggctgcagctgacctcttcgctggcatg
gcctacctcttcctcatgttccatactggcccccgcaccgccaggctctccatcaaaggc
tggttcctgcgacagggcctgctggacaccagcctcacggcatcggtggccacgttgctg
gccattgctgtggaacggcaccgcagtgtgatggctgtgcagctgcacagccgcttgccc
cggggtcgtgtggtcacactcatcgtgggagtgtgggtggctgcgctgggtctggggttg
ctgcctgcacacttctggcactgcctctgtgacttggacagctgctcacgaatggtgccc
ctgttcagccgctcctacctggctgtgtgggccctatccagcctgcttgtcttcctactc
atggtagccgtctacacacgaattttcttctttgtgcgcagacgggttgaacgcatggca
gagcacgtcagctgccatccccgctaccgagagacaacgctcagcctagtcaagacagtt
gtcatcattctgggggcatttgtggtgtgctggacaccggggccaggtggtgctgctctt
ggacggtctggactgtaa

KEGG   Rattus norvegicus (rat): 500317
Entry
500317            CDS       T01003                                 

Gene name
Lpar5
Definition
(RefSeq) lysophosphatidic acid receptor 5
  KO
K08390  lysophosphatidic acid receptor 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04072  Phospholipase D signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    500317 (Lpar5)
   04072 Phospholipase D signaling pathway
    500317 (Lpar5)
   04151 PI3K-Akt signaling pathway
    500317 (Lpar5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    500317 (Lpar5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    500317 (Lpar5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    500317 (Lpar5)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    500317 (Lpar5)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 500317
NCBI-ProteinID: XP_003749883
RGD: 1562580
Ensembl: ENSRNOG00000021401
UniProt: D4ADR1
Position
4
AA seq 384 aa
MPQTSFSPHLDAMFANSSANTSSTDSSVPQCRDYRSTHRLHMVVYSLVLATGLPLNALAL
WVFLRVLRVHSVVSVYMCNLAASDLLFTLSLPLRLSYYARHHWPFPDFLCQTSGAIFQMN
MYGSCIFLMLINVDRYAAIVHPLRLRHLRRPLVARRLCLGVWALILLFAVPAARVHSPTT
CKYENVTLSLCFESFSDELWKGRLLPLLLLAETLGFLLPLAAVVYSSGRVFWTLARPDAT
QSHRRQKTVRLLLANLIIFLLCFVPYNSTLAVYGLLRANLVKNSLQARDQVRGVLMIMVL
LAGANCVLDPLVYYFSAEGFRNTLRNLGAPFHTRPLPTNGTRGELTEPPSESTQNTGQDA
TSQRLLQPANLGTRTDNGPQDSAL
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgcctcagactagtttctctccccacctggacgccatgtttgccaattcttcagccaac
acctcttctaccgacagctctgtgccccagtgccgtgactatcggagtacacatcgtttg
catatggtggtctacagcttggtgttggcaaccggtcttcctctcaacgctctggctctc
tgggtcttcctgcgtgtactgcgcgtacactcggtggtgagtgtgtacatgtgcaacctg
gcagccagcgacttgctcttcaccctgtcacttcccctgcgcctctcctactatgcacgg
caccactggcccttcccagacttcctgtgccagacgtcgggcgccatcttccagatgaac
atgtatggcagctgtatctttctgatgctcatcaacgtggaccgctatgcggccatcgtg
catccgctgagactgcgccatctgcggcggcccctcgtggcgcggcggctctgcctgggc
gtgtgggctctcatcctgctgttcgccgtgcccgccgcccgcgtgcacagcccgaccacc
tgcaagtacgagaacgtcaccctgagcctgtgcttcgagagcttcagcgatgaactgtgg
aagggcaggctgctgccactcctgctgctggccgagaccctgggctttctgctgcccctg
gcggctgtcgtctattcgtccggcagggtcttctggacactggcgaggcccgacgccact
cagagccaccggcgacagaagaccgtgcgcctcctactggccaacctcatcatctttctg
ctgtgcttcgtgccctacaactccacgctggcagtttatgggttgctgcgggccaacctg
gtaaagaacagccttcaggcccgcgatcaggtgcgcggagtgctgatgataatggtgctg
ctggccggtgccaactgcgtgctggatccgctggtttactacttcagcgccgagggtttt
cgtaacactcttcgaaacctgggcgctccgtttcataccaggcctttgcctaccaatggg
actagaggggagctcaccgaaccaccctcagaaagcacccaaaacactgggcaggatgcc
accagccagaggctacttcaacctgccaatctgggtacacgcacggacaacggcccccaa
gattcagccctctga

KEGG   Rattus norvegicus (rat): 66025
Entry
66025             CDS       T01003                                 

Gene name
Lpar3
Definition
(RefSeq) lysophosphatidic acid receptor 3
  KO
K04294  lysophosphatidic acid receptor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04151  PI3K-Akt signaling pathway
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    66025 (Lpar3)
   04072 Phospholipase D signaling pathway
    66025 (Lpar3)
   04151 PI3K-Akt signaling pathway
    66025 (Lpar3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    66025 (Lpar3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    66025 (Lpar3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    66025 (Lpar3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    66025 (Lpar3)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 66025
NCBI-ProteinID: NP_076459
RGD: 620565
Ensembl: ENSRNOG00000015260
UniProt: Q8K5E0
Position
2
AA seq 345 aa
MDFFYNRSNTDTADEWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVITNRKFHFPFYYLL
ANLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWLLRQGLLDTSLTASLANLLVIAVERHM
SIMRMRIHSNLTKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLAPIYSRSYLI
FWTVSNLLAFFIMVVVYVRIYMYVKRKTNVLSPHTSGSISRRRAPMKLMKTVMTVLGAFV
VCWTPGLVVLLLDGLNCKQCNVQHVKRWFLLLALLNSVMNPIIYSYKDEDMYNTMRKMIC
CAPHDSNAERHPSRIPSTIHSRSDTGSQYLEDSISQGQVCNKSSS
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggactttttctacaacaggagcaacacagacacggcggacgagtggacggggacgaag
ctcgtgatcgtcctgtgcgttgggacattcttctgcctctttatatttttttctaactcc
ctggtcatcgcagcagtgatcacgaataggaagttccactttcccttctactacctgctg
gctaacttggcggctgcggatttctttgccggaatcgcttatgtgttcctgatgtttaac
accggcccggtgtcgaaaaccttgactgtcaaccgctggcttctccgccaggggctccta
gacacaagcctgacggcctccctggccaatctgctggtaattgctgtggaaagacacatg
tcaatcatgaggatgagaatccacagcaacttgaccaaaaaacgggtgacgctgctcatc
ctgctggtgtgggccatagccattttcatgggggcggtccccacgctgggctggaattgc
ctctgcaacatctcagcctgctcctctctggccccgatttacagcaggagttacctcatc
ttctggacggtgtcaaacctcctggccttcttcatcatggtggtggtgtacgtgcgcatc
tacatgtatgtcaagaggaaaaccaacgtcctctctccgcacacgagtggctccatcagc
cgccggagggcccccatgaagctaatgaagacggtgatgactgtcttaggagccttcgtg
gtgtgctggaccccgggtctcgtggtgctgctgctggacggcctgaactgcaagcagtgt
aatgtgcagcacgtgaagcgctggttcctgctgctggcgctgctcaactccgtcatgaac
cccatcatctactcgtacaaggacgaggacatgtacaacaccatgcggaagatgatctgc
tgtgccccgcacgacagcaacgccgagaggcacccctcccgcatcccctctaccatccac
agcaggagcgacacgggcagccagtacctggaggacagcatcagccagggccaggtgtgc
aataaaagcagctcctaa

DBGET integrated database retrieval system