KEGG   Rattus norvegicus (rat): 116498
Entry
116498            CDS       T01003                                 

Gene name
F2rl3
Definition
(RefSeq) proteinase-activated receptor 4
  KO
K04236  coagulation factor II (thrombin) receptor-like 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04610  Complement and coagulation cascades
rno04611  Platelet activation
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    116498 (F2rl3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    116498 (F2rl3)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    116498 (F2rl3)
   04611 Platelet activation
    116498 (F2rl3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116498 (F2rl3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    116498 (F2rl3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Thrombin
    116498 (F2rl3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srw 7TM_GPCR_Srx 7TM_GPCR_Srv 7TM_GPCR_Str
Other DBs
NCBI-GeneID: 116498
NCBI-ProteinID: NP_446260
RGD: 620872
Ensembl: ENSRNOG00000048186
UniProt: Q920E0
Position
16
AA seq 386 aa
MLGFSISPAECQTPSIYDDVESTREGQEASLRPTVELNESKSPDKPNPRGFPGKPCANNS
DTLELPASSEALLLGWVPTRLVPAIYGLVVVVGLPANGLALWVLATRVPRLPSTILLMNL
AVADLLLALVLPPRLVYHLRGQRWPFGEAACRVATAALYGHMYGSVLLLAAVSLDRYLAL
VHPLRARALRGQRLTTILCLVAWLSAATLVLPLTFHRQTFLLAGSDRMLCHDALPLAEQT
SHWRPAFICLAVLGCFVPLLAMVLCYGATLRALAANGQRYSHAVRLTALVLFSAVAAFTP
SNVLLVLHYSNPSPEAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSHEFREKVRAMLCRQ
LKASSSSQASREAGSRGTAICSSTLL
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgctcgggttcagcatcagcccggcggaatgccagacgcccagcatctacgacgatgta
gagagtaccagggaaggccaagaagcctctctgcgtcccacagtagaacttaatgagtcg
aagtccccagacaagcctaatccacgaggcttcccgggcaagccctgtgccaacaacagt
gacacgctggagctcccagccagctctgaagcactgcttctggggtgggtccccacgagg
ctggtacctgccatctatgggctagtggtggtcgtggggctgcctgccaatgggctagcg
ctgtgggtgctggccacaagggtcccacgcttgccatccaccattctgctcatgaacctg
gcagtggctgacttgctactggccctggtgctcccaccacgactggtttatcacctgcgt
ggccagcgctggccgtttggggaggctgcctgccgggtggccacagctgccctctatggc
cacatgtatggttcagtgttgcttctggccgcagtcagcctggacagatacctggccctg
gtgcatcctttgcgggcccgggcattgcgtggtcaacgcctcaccaccatactctgcttg
gtggcctggctctctgcagccactctagtcttgccactcacgtttcatcggcagaccttc
ctattggctggctccgatcgcatgctgtgtcatgatgcgctgccattggcggagcagacc
tcccattggagaccggccttcatctgcctggctgtcctgggctgctttgtgccactgctg
gccatggtcctgtgctatggggccacccttcgtgcactggcagccaatggtcagcggtac
agccatgcagtgagactgacagccctggtcctgttctcagcagtggccgctttcacacct
agcaatgtgcttctggtgctgcactattcaaacccaagccctgaggcctggggcaatctc
tatggagcctatgttcccagcctggcactcagcacccttaacagctgcgtagaccctttc
atctactactatgtgtcccacgagttcagggagaaggtacgggctatgttgtgtcgccag
ctgaaggccagcagctcctctcaggcctccagggaggctggaagccgagggactgccatt
tgctcctctacacttctgtga

KEGG   Rattus norvegicus (rat): 29636
Entry
29636             CDS       T01003                                 

Gene name
F2rl2
Definition
(RefSeq) proteinase-activated receptor 3 precursor
  KO
K04235  coagulation factor II (thrombin) receptor-like 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29636 (F2rl2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    29636 (F2rl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    29636 (F2rl2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Thrombin
    29636 (F2rl2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 29636
NCBI-ProteinID: NP_445765
RGD: 620871
Ensembl: ENSRNOG00000018054
UniProt: Q920E1
Position
2
AA seq 368 aa
MEMKVLILVGVRLLFLPTTVCQSGMKHVSDNSALTAESFNGNEHSFEEFPLSDIEGWTGA
TTTIKAKCPEESITTLHVNNATMGYLRSSLSTKVIPAIYILVFVIGVPANIVTLWKLSSR
TKSICLVIFHTNLAIADLLFCVTLPFKIAYHLNGNDWVFGEVMCRVTTVAFYGNMYCAIL
ILTCMGINRYLATVHPFTYRKLPKRNFTLLMCGVVWVMVVLYMLPLAILKQEYHLVQPGI
TTCHDVHDTCESPLPFQFYYFVSLAFFGFLIPFVVSVFCYTTLIHKLNAQDRKWLRYIKA
VLLILVIFTICFAPTNIILIIHHANYYYSNTDSLYFMYLIALCLGSLNSCLDPFLYFIMS
KIVDQLTS
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggagatgaaagtccttatcttggttggggttaggctgctgtttctgccgaccactgtt
tgccaaagtggcatgaaacatgtttcagacaactcagccttaactgctgagagttttaat
ggcaacgaacattcctttgaagaattcccactttctgacatagagggctggacaggagcc
accacaactataaaagcgaagtgtcccgaagaaagcattacaactctccatgtgaataat
gctaccatgggatacctgagaagttccttaagtaccaaagtgatacctgccatctacatc
ctggtgtttgtgattggtgtaccagcgaacatcgtgaccctgtggaaactctcctcaagg
accaaatccatctgtctggtcatctttcacaccaacctggccatcgcggatctccttttc
tgtgtcacgctgccgtttaagatcgcctaccatctcaatgggaacgactgggtctttggc
gaggtcatgtgccgggtcaccacggtcgctttctacggcaacatgtattgtgctattctc
atcctcacctgtatgggcatcaaccgctacctggccacggtccatcccttcacataccgc
aagctgcccaaacgcaacttcactttgctcatgtgtggcgtggtgtgggtcatggtggtc
ttatatatgttgccgttggccatcctcaagcaggagtaccatcttgtccaaccagggatc
accacctgccacgacgtccacgacacatgcgagtccccgttgcccttccagttctactac
ttcgtctccttggccttctttgggttccttatcccatttgtggtcagtgtcttctgttac
acgactctcatccacaagcttaacgcgcaggatcgcaaatggctgaggtacatcaaggcg
gttctcctcatccttgtgattttcaccatctgctttgcccccaccaacatcatactcata
attcaccacgccaactactactacagcaacactgatagcttgtactttatgtatctcata
gctctctgcctgggcagcctgaatagttgcctagacccattcctttattttatcatgtca
aaaattgtagatcagctgacctcgtag

DBGET integrated database retrieval system