KEGG   Rattus norvegicus (rat): 116501Help
Entry
116501            CDS       T01003                                 

Gene name
Slc9a3r2, E3karp
Definition
(RefSeq) SLC9A3 regulator 2
  KO
K13358  Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    116501 (Slc9a3r2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    116501 (Slc9a3r2)
Transporters [BR:rno02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   116501 (Slc9a3r2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ EBP50_C PDZ_2 GRASP55_65
Motif
Other DBs
NCBI-GeneID: 116501
NCBI-ProteinID: NP_446263
RGD: 620380
Ensembl: ENSRNOG00000002997
UniProt: Q920G2 G3V6D9
Position
10q12
AA seq 337 aa AA seqDB search
MAAPESLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVN
GVNVEGETHHQVVQRIKAVEGQTQLLVVDKETDEELCRRQLTCTEEMAHRGLPPAHNPWE
PKPDWACSGSLGSDTGQKDVNGPPRELRPRLCHLRRGPQGYGFNLHSDKSRPGQYIRSVD
PGSPASLSGLRAQDRLIEVNGQNVEGLRHAEVVARIKAQEDEARLLVVDPETDEHFKRLR
VVPTEDHVEGPLPSPVTNGTSLAQLNGGSVCSSRSDLPGSEKDNEDGSAWKRDPFQESGL
HLSPTAAEAKEKARATRVNKRAPQMDWNRKREIFSNF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgccggagtcgctgcggccccgcttgtgtcgcctggtgcggggcgagcaaggg
tacggcttccacctgcatggcgagaaaggccgccgtggccagttcatccggcgcgtggag
ccaggctccccagccgaggcggccgcgctgcgcgccggggaccgcctggttgaggtcaac
ggcgtcaacgtagagggcgagacgcatcaccaggtggtccagaggatcaaggctgtggag
ggacagacccagctgcttgtggtggacaaggagacagatgaggaactctgccggcggcaa
ctgacctgcactgaggagatggcccatcgagggcttccgccagcccacaacccctgggag
ccaaagccggactgggcatgctcaggcagtcttggctcggacacaggccagaaggatgtc
aatgggcccccaagagagctgcgtccccggctctgccacttacgaaggggaccccagggc
tacggattcaacctgcacagtgacaagtctcggcctggccaatacatccgctctgtggac
cctggctctcctgcttctctctctggcctccgggcccaagaccggctcattgaggtgaat
gggcagaatgtggaggggctgcgccatgccgaagttgttgccagaatcaaggcacaggag
gatgaggcccggttgctggttgtagaccccgagactgatgaacacttcaaacggttgcgg
gtcgtacccaccgaggatcacgtggaaggtccactgccatcaccagtcacgaacgggacc
agccttgcccagctcaatggtggctccgtgtgctcttcccgaagcgacctgccaggctca
gagaaggacaatgaggatggcagtgcttggaagagagaccccttccaggaaagtggtctc
cacctgagccccacagcagccgaggccaaggagaaggctcgagctactcgggtcaataag
agagcaccacagatggactggaaccggaagcgagagatcttcagcaacttctga

DBGET integrated database retrieval system