KEGG   Rattus norvegicus (rat): 116502
Entry
116502            CDS       T01003                                 

Gene name
Bak1
Definition
(RefSeq) bcl-2 homologous antagonist/killer
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04141  Protein processing in endoplasmic reticulum
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05160  Hepatitis C
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05203  Viral carcinogenesis
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05216  Thyroid cancer
rno05217  Basal cell carcinoma
rno05218  Melanoma
rno05220  Chronic myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    116502 (Bak1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    116502 (Bak1)
   04215 Apoptosis - multiple species
    116502 (Bak1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116502 (Bak1)
   05202 Transcriptional misregulation in cancer
    116502 (Bak1)
   05206 MicroRNAs in cancer
    116502 (Bak1)
   05203 Viral carcinogenesis
    116502 (Bak1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    116502 (Bak1)
   05212 Pancreatic cancer
    116502 (Bak1)
   05225 Hepatocellular carcinoma
    116502 (Bak1)
   05226 Gastric cancer
    116502 (Bak1)
   05214 Glioma
    116502 (Bak1)
   05216 Thyroid cancer
    116502 (Bak1)
   05220 Chronic myeloid leukemia
    116502 (Bak1)
   05217 Basal cell carcinoma
    116502 (Bak1)
   05218 Melanoma
    116502 (Bak1)
   05213 Endometrial cancer
    116502 (Bak1)
   05224 Breast cancer
    116502 (Bak1)
   05222 Small cell lung cancer
    116502 (Bak1)
   05223 Non-small cell lung cancer
    116502 (Bak1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    116502 (Bak1)
   05160 Hepatitis C
    116502 (Bak1)
   05164 Influenza A
    116502 (Bak1)
   05162 Measles
    116502 (Bak1)
   05168 Herpes simplex virus 1 infection
    116502 (Bak1)
   05163 Human cytomegalovirus infection
    116502 (Bak1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    116502 (Bak1)
   05169 Epstein-Barr virus infection
    116502 (Bak1)
   05165 Human papillomavirus infection
    116502 (Bak1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    116502 (Bak1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    116502 (Bak1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    116502 (Bak1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    116502 (Bak1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    116502 (Bak1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    116502 (Bak1)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   116502 (Bak1)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 116502
NCBI-ProteinID: NP_446264
RGD: 621635
Ensembl: ENSRNOG00000000485
Vega: OTTRNOG00000001957
UniProt: Q9JK59
Position
20
AA seq 209 aa
MASGQGPGPPKGDCDEALSASEQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDN
LSLEPNSVLGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSG
ISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALS
LRRDPILSVVVIFGVVLLGQFVVHRFFRS
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcatccggacaaggaccaggtcctcccaagggggactgcgatgaggccctgtctgct
tctgaacagcaagttgcccaggacacagaggaggtctttcgaagctacgttttttacctc
caccagcaggaacaagagacccagggggcagccgcccctgctaaccctgagatggacaac
ttgtccctagaacccaacagtgtcttgggtcaggtgggtcggcagcttgctctcatcgga
gacgatattaatcggcgctacgacacggagttccagaatttactggaacagcttcagccc
accgctgggaatgcctacgaactcttcaccaagatcgcctccagcctatttaagagcggc
atcagctggggccgtgtggtggctctcctgggctttggctaccgtctggccctgtatgtc
taccagcgtggtttgactggcttcctgggccaggtgacctgctttttggctgatatcata
ctacaccattacattgccagatggattgcacagagaggtggttgggtggcagccctgagt
ttgcgtagagaccccatcctgagtgtagtggtaatttttggtgtggttctgttgggccaa
tttgtggtacacagattcttcagatcatga

DBGET integrated database retrieval system